KEGG   Bifidobacterium animalis subsp. lactis BB-12: BIF_01751Help
Entry
BIF_01751         CDS       T01840                                 

Definition
(GenBank) Hypothetical RNA binding protein
  KO
K07574  
RNA-binding protein
Organism
bbb  Bifidobacterium animalis subsp. lactis BB-12
Brite
Ribosome biogenesis [BR:bbb03009]
 Prokaryotic Type
  Other maturation factors
   BIF_01751
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1443651..1443956)
Genome map
AA seq 101 aa AA seqDB search
MALTKKQVRQLRAMANQLKPLVQIGKGDLSDNVIKQADETIEKRELIKVQVLDGSGIDAK
EAAQGLADRMGAEVVQVIGNRAVLYRRSHRDDIEHIQLVRE
NT seq 306 nt NT seq  +upstreamnt  +downstreamnt
atggcattgacgaagaagcaggtcaggcagctgcgcgcgatggcgaaccagctcaagccg
ctcgtacagatcggcaaaggcgatctgagcgacaacgtgatcaagcaggcggacgagacg
atcgagaaacgcgagctcatcaaagtgcaggtgctcgacggctcgggcatagacgccaag
gaggccgcacagggactcgccgatcgcatgggggccgaggtagtccaggtgatcggcaac
cgtgccgtgctctaccgtcgttcacatcgcgacgacatcgagcacatccagcttgtgcgc
gaatag

DBGET integrated database retrieval system