KEGG   Bifidobacterium animalis subsp. lactis BB-12: BIF_01792Help
Entry
BIF_01792         CDS       T01840                                 

Definition
(GenBank) Hypothetical protein
Organism
bbb  Bifidobacterium animalis subsp. lactis BB-12
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1429047..1430015
Genome map
AA seq 322 aa AA seqDB search
MASDKKNGRGSKKGESITVAERKARKVAERLAREAKSSETLSAVWSLPPAQLLRFHSHTH
LVDIDAGSKPGFDGDQEAGERFIADSSSEIANYQRLMYANGIHGDTHRVLIVLQGMDASG
KGGIVRHVFSQVDPMGIHYHGFGKPSEEDLAHDYLWRIRRELPSNGWISIFDRSQYEDIV
MPRITGSLPEETWRARYGQINDFEAELAGSGCAIIKIFLVSSRQAQRQHFLRRLDDPTRY
WKFDPSDLEARDRWDDYMAAWQEVFERTSTSIAPWYLIPADKRWYSRMVVSELLRTTMKN
FNQTWPPLDADRDEALARLGVE
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atggcaagcgacaagaaaaacggcagaggttcgaaaaaaggcgaatcaatcacggtggca
gaacgcaaggccaggaaggtggccgaacgcctcgcccgggaggcgaagagcagtgaaacg
ctcagtgccgtatggtcgttgcccccggcgcagttattgcggttccattcacatacgcat
ttggtcgacatcgatgccgggtcgaaaccggggtttgacggtgaccaagaggctggtgag
cggttcattgccgacagcagctccgaaatagccaactatcagcggctcatgtatgccaat
ggcatccatggcgacacgcatcgcgtgctcatcgtgctgcagggcatggacgcctccggc
aaaggcggcattgtgcgccatgtattcagtcaggtggatccaatgggtattcactaccat
ggctttggcaaaccaagcgaggaggatctcgcccatgactacctgtggcgtattcgcagg
gagttgccgtcaaatggctggatatccatcttcgatcgttcgcagtacgaggacatcgtg
atgccacgcatcacaggttccctgcctgaggagacatggcgcgcacggtatgggcagatc
aatgacttcgaagcagagctcgccgggtcaggttgcgcgatcatcaagatttttctcgtg
tcgagcaggcaagcgcagcgacagcacttcctgcgacgtctcgatgatccgacacgatac
tggaagttcgacccctccgatctcgaagcccgtgacagatgggatgattacatggcggcc
tggcaggaggtattcgaacggacgagcacctcgattgccccgtggtatctgatccccgcg
gacaagagatggtactcacgtatggtcgtttctgagttgctgcgcacgaccatgaagaat
ttcaaccagacctggccgccactcgacgccgaccgtgatgaggcgttggccagactcggc
gtcgagtga

DBGET integrated database retrieval system