KEGG   Bifidobacterium animalis subsp. lactis BB-12: BIF_01802Help
Entry
BIF_01802         CDS       T01840                                 

Definition
(GenBank) hypothetical transporter (sulfate transport family)
Organism
bbb  Bifidobacterium animalis subsp. lactis BB-12
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4191 DUF4203 ABC_membrane DUF4396 DUF2207
Motif
Other DBs
NCBI-ProteinID: ADC85724
UniProt: D3R4Q0
Position
complement(1463811..1464638)
Genome map
AA seq 275 aa AA seqDB search
MPVFVLKQAREGYMAQQEKSEKPKKRGMFEQIVTIYKFTAAEDKALPWITGAVFAAPIVV
GIICGIVFHWGWVSWITLMILAVMIGLLLFTIVLTRRADNVGYKQMEGKSGAAISILGNM
KRAGFDFPQEPVWVDPRTRDAVWRGTGYQGIYLIGEGNYGRVMQAMDRQEKQIKGVTAGS
HIPVYRICVGDGPKQVRLKDLRNTVLKKKTYVPNNYTNPIMRKLHPRHRFALSKPQLITL
NDRLHTLQRRSGMGIPKGMDPMKTHKVSRRAIRGR
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
ttgcccgtattcgtgttgaaacaagctagagagggatacatggcgcagcaagagaagtct
gagaagccaaagaaacgcggaatgttcgagcagatcgtcacgatctacaagttcacggca
gccgaggacaaggcgctgccatggatcaccggcgcagtgttcgccgccccgatcgtcgtg
ggcatcatctgcggcatcgtgttccattggggttgggtctcgtggatcacgctgatgatt
ctcgccgtgatgattggattgctgctgttcacgatcgtgctcacccgccgtgccgacaat
gtcgggtacaagcagatggaaggcaagtccggtgccgcgatcagcattctcggcaacatg
aagcgcgccggattcgatttcccgcaggaaccggtgtgggtcgacccgcgtacccgtgac
gcagtgtggcgcggcaccgggtatcagggcatctacctgatcggcgaaggcaattacggt
cgcgtgatgcaggcgatggaccgccaggaaaagcagatcaaaggcgtgactgcgggttcg
catattcccgtctaccgcatctgcgtgggagacggtcccaagcaggttcgtctcaaggat
ctgcgcaatacggtgctcaagaagaagacgtacgtgccgaacaactacaccaatccaatc
atgcgcaagcttcatccgcgccatcgtttcgcactctccaaaccgcagctcatcacactg
aacgaccgcttgcatacactgcagcgccgtagcggcatgggcattcccaagggcatggac
ccgatgaagacgcacaaggtgagccgtcgcgcgatacgcggcaggtga

DBGET integrated database retrieval system