KEGG   Bifidobacterium animalis subsp. lactis BB-12: BIF_01803Help
Entry
BIF_01803         CDS       T01840                                 

Definition
(GenBank) Dihydrolipoamide dehydrogenase
  KO
K00382  
dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
bbb  Bifidobacterium animalis subsp. lactis BB-12
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Glycine, serine and threonine metabolism
Valine, leucine and isoleucine degradation
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bbb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BIF_01803
   00020 Citrate cycle (TCA cycle)
    BIF_01803
   00620 Pyruvate metabolism
    BIF_01803
   00630 Glyoxylate and dicarboxylate metabolism
    BIF_01803
   00640 Propanoate metabolism
    BIF_01803
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BIF_01803
   00280 Valine, leucine and isoleucine degradation
    BIF_01803
Enzymes [BR:bbb01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.4  dihydrolipoyl dehydrogenase
     BIF_01803
Exosome [BR:bbb04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   BIF_01803
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1464698..1466221)
Genome map
AA seq 507 aa AA seqDB search
MSPCMGTNETGTKRMTSEHYDVVIIGAGPGGYTVALRSAELGKSVLLVERDDVVGGTCLN
RGCIPSKALITATRTIDTIHRGEQIGIDCELQEIDFGKLRAFRDGTVSTMRDGLLALLTF
RGVHMVQGIASVVEDGHVHVRPAQGGQTIRIRTADGDFKDGGQSLDVTAGDVVIATGSRP
KPLDVAPFNHVLIDSTRALALNSFPHSAVVIGSGATALEFASMWNSAGADVTLIMRGDIV
LSRSDRRAAKILMRELKRQGITIVTNAAITAVDTGENLGVTVHYTDADGNGQEVFAEWAL
AAIGRVPNTDGAWFAKASIELDENGLVKTDAYGRTSREHVWALGDITPGHQLAHRAYQQG
YVVAETIAGLDPSPVDEYTIPTVVFSNPEFASVGYTLREAKADTELVDVTETLIPVMSNA
RMLMSGASGSVSVVSGKKSADQSDDVHVLGVHIVSPDASDLIAEAQQIIGNHVPLSAAAR
NIHPHPTFSEMLGETLLKADGRPLHTR
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgtcgccgtgcatgggaacaaacgaaacaggaacgaagcgtatgacgagtgaacattac
gacgtggtaattatcggcgcaggccccggcggctacacagtggcgctgcgctcggcggaa
ctgggcaaatcagtgctgttggtggaacgcgacgatgtggtgggtggcacatgcctcaac
cgcgggtgcattccgtcgaaggcactcatcacggcaacgcgcaccattgacacgatacat
cgcggcgaacagatcggcatagactgcgagctgcaggaaatcgacttcggcaaactgcgt
gcgttccgcgatggcacggtctcgacgatgcgcgacggactgctcgcgctgctcaccttc
cgcggcgttcatatggtgcagggcatcgcctcggttgtagaggacggccatgtccatgtg
agaccggcacagggcgggcaaacgatccgcatccgcactgcagacggcgatttcaaggac
ggtgggcaatctctcgacgtcaccgcaggcgatgtggtgatcgccaccggctcacggccg
aaaccgcttgatgtggcgccgttcaatcatgtgctcatcgactcgacgagagcactggca
ctcaactccttcccacacagcgccgtggtgattggttcgggggccacggcgcttgaattc
gcgtcgatgtggaattccgcaggagcagacgtcacgctcatcatgcgcggcgacatcgtg
ctctcccgctccgacaggcgggctgcgaagatactgatgcgcgaactgaagcgacagggc
atcacgatcgtgacgaacgctgccatcacggcggtcgacactggggagaatctgggtgtc
accgtgcattacacggacgcagacggcaacgggcaggaggtattcgccgagtgggcgctc
gcagccatcgggcgtgtgccgaataccgacggcgcatggttcgcgaaggcatcgattgag
ctcgatgagaacggtttggtgaaaacggatgcctacggccgcaccagccgggaacatgtg
tgggcgttgggcgacatcaccccagggcaccaactggcacaccgtgcatatcaacaaggc
tatgtggtggccgaaacgattgccggactcgatccctccccggtggacgaatacacgatc
ccaaccgttgtgttctcgaacccggaattcgcctccgtcggctacacgctgcgcgaagcc
aaggccgacaccgagctcgtcgacgtaaccgaaacgctcatcccggtcatgtcgaacgcg
cgcatgctgatgagcggggcatccggttcagtgtcggtggtgagcgggaagaagtccgca
gatcaatcggatgacgttcatgtgctcggcgtgcatatcgtctcccccgacgccagcgat
ctgatcgccgaggcacagcagatcataggcaaccatgttccattgagcgctgccgcgcgc
aacattcacccgcacccgaccttcagcgagatgctcggggaaacgctgctcaaagccgat
ggccgaccgttgcacacccgctga

DBGET integrated database retrieval system