KEGG   Bifidobacterium animalis subsp. lactis BB-12: BIF_01844Help
Entry
BIF_01844         CDS       T01840                                 

Definition
(GenBank) Hypothetical membrane spanning protein
Organism
bbb  Bifidobacterium animalis subsp. lactis BB-12
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1366942..1367733)
Genome map
AA seq 263 aa AA seqDB search
MDAHLNMTNFVCIHIVFVWNRVIEYAGRPNSGALRKGFSMVRSRTAQLIFQSFYCAFGIV
GILGSFGMYDGSFDNVFYVYFTNLSNYLCIAVMFFELVQTANRKQDGYVKLSPALKFISV
TAILLTFFVFNLLLANAPDRNPLENFKVTSITFHVVLPLMFVADWLLFYEHRKVKWTYPL
YSTVFPLVYLAFVYMRAWLVNFDTAVPKLYPYFFIDANQQGIAGVVRWCLILLAAFIVLG
YILMAVDRMMPAAKESTPIDSAD
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
gtggatgcacacttgaacatgacgaattttgtgtgcatccacatagtatttgtatggaat
cgtgtcatagaatatgcgggtcgcccgaattcaggggcattgcggaaaggtttttctatg
gtacggagcagaaccgctcaactcattttccaatcgttctactgtgcattcggcatagtg
ggaatactcggcagcttcggcatgtatgacggcagcttcgacaacgtgttctacgtgtat
ttcacgaacctgtcgaattacctgtgcattgccgtcatgttcttcgaactcgtgcagacg
gccaaccgcaagcaagacggctatgtgaagctctcccccgccttgaagttcatttcggtc
actgccattctcctcacgttcttcgtgttcaacctgctgcttgccaatgcaccggatcgc
aacccgctcgagaacttcaaagtcacgagcatcacgttccatgtggtgctgccgctcatg
ttcgttgccgattggctcctgttctacgagcataggaaagtgaagtggacgtacccgctc
tattccacggtgttcccgcttgtctacctcgccttcgtctatatgcgcgcgtggctggtc
aactttgacaccgcggtgccgaaactctacccgtatttcttcatcgatgccaatcagcag
ggcattgcaggcgtggtgcgttggtgcctgattctgcttgccgcattcattgtgctcggt
tacattctgatggccgtggaccgtatgatgccggccgcaaaggaatccacacccatcgat
tccgccgactga

DBGET integrated database retrieval system