KEGG   Bifidobacterium animalis subsp. lactis BB-12: BIF_01846Help
Entry
BIF_01846         CDS       T01840                                 

Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
bbb  Bifidobacterium animalis subsp. lactis BB-12
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:bbb00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    BIF_01846
Enzymes [BR:bbb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     BIF_01846
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1375390..1376031
Genome map
AA seq 213 aa AA seqDB search
MGGTMSEQSRQSQATERQGGRLIVLTGPTAVGKGTVETALRKAHPEVWVSVSATTRDPRP
GERDGVNYWFISEPEFLRRQEAGEFLETAVVHGMAHYGTPLEPVREHLAGNVPTILEIDL
QGARRVKERAKELGLDVVYVFIAPPSFDELKKRLIGRGTETPEQQAKRLETAKVELAAEP
EFDVTIVNEQVDKAARDLWNVIAQEYGLPQDTD
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
ttgggaggaacaatgagcgaacaatcccggcaatcgcaggcaaccgagcggcaaggcggc
cggctgatcgtactcaccggccccacagccgtgggcaagggcaccgtcgagacggcgtta
cgcaaggcgcatccggaggtctgggtttcggtctccgccaccacgcgcgatccacggccg
ggggaacgcgatggcgtgaactactggttcataagcgaacccgaattcctgcgcaggcag
gaggcgggggagttcctcgaaaccgccgtcgttcatggcatggcgcactacggcacgccg
ttggaacccgtacgtgagcacttggcagggaacgtgccgacaatcctcgagatcgacctg
cagggtgcgcgccgcgtcaaggagcgcgcgaaggaactcggactcgacgtggtttacgtg
ttcatcgcgccaccaagcttcgacgagctcaagaaacgtctgatcgggcgtgggacggag
acgcctgaacagcaggcgaagcggctcgagaccgcgaaggtggagctggcggcggagccc
gagttcgatgtgacgatcgtgaacgagcaggtggacaaagcggcacgggacctgtggaat
gtcatcgcacaggaatacggcttgccacaggataccgactga

DBGET integrated database retrieval system