KEGG   Bifidobacterium animalis subsp. lactis BB-12: BIF_01901Help
Entry
BIF_01901         CDS       T01840                                 

Definition
(GenBank) Triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bbb  Bifidobacterium animalis subsp. lactis BB-12
Pathway
bbb00010  Glycolysis / Gluconeogenesis
bbb00051  Fructose and mannose metabolism
bbb00562  Inositol phosphate metabolism
bbb01100  Metabolic pathways
bbb01110  Biosynthesis of secondary metabolites
bbb01120  Microbial metabolism in diverse environments
bbb01130  Biosynthesis of antibiotics
bbb01200  Carbon metabolism
bbb01230  Biosynthesis of amino acids
Module
bbb_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:bbb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BIF_01901
   00051 Fructose and mannose metabolism
    BIF_01901
   00562 Inositol phosphate metabolism
    BIF_01901
Enzymes [BR:bbb01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     BIF_01901
Exosome [BR:bbb04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   BIF_01901
  Exosomal proteins of bladder cancer cells
   BIF_01901
  Exosomal proteins of melanoma cells
   BIF_01901
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ADC85865
UniProt: D3R541
Position
complement(1609256..1610128)
Genome map
AA seq 290 aa AA seqDB search
MAPGNRYWAPRSHMEDRQGNMASTRRIPMVAGNWKMNFDHLEATEFVRAFSKNLKRCHFD
FNRCEVALFPSFTSIRSVQVMVESEHLRIRYGAQAVSVTSQGAFTGDVSADMLAHLGCSY
VIVGHSERRKYHPEDDANIVDQVRAVLAAGMQPILCVGESLEERRKGIELEFAVGQVHDV
TRDLSDGEASKLIIAYEPVWAIGTGMVATPQTAQDAAHAFRVDLAKSFGDHVAQTVRVLY
GGSVSSKNCVELIEEPDVDGFLIGGAALDVDELTTICRKTIATTSSHDNS
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
gtggcgcccggcaataggtactgggcgccacgttctcatatggaggacaggcaaggcaat
atggcatcgacacgacgcatccccatggttgcgggcaattggaagatgaacttcgatcat
cttgaggcgaccgagttcgtccgggcattctccaagaacctcaaacgatgccattttgac
ttcaatcgttgcgaagtggcgctcttcccgtcattcacctcgattcgtagcgttcaggtg
atggtggaatccgaacacttgcgcatcagatacggggcccaggccgtttcggtcacgtca
cagggggcgttcaccggtgacgtctctgcggacatgctcgcgcatctgggttgcagctat
gtgattgtaggccattcggaacggcgcaaataccatccggaggacgatgcgaacatcgtc
gatcaggtacgagcggtgcttgccgccggcatgcagccaatcctatgcgtcggcgagagt
ctggaggagaggcgaaagggcattgaacttgagtttgccgtcggacaggtgcatgacgtg
acacgcgacctttccgatggggaggcatcaaaactcatcatcgcctatgaacccgtctgg
gcgattggcacgggcatggttgctacaccgcagacagcgcaggacgccgcccatgccttc
cgcgtggatctggcgaaatcattcggcgaccatgtggcgcagaccgtgcgtgtactgtat
ggaggctcggtgtcttcgaagaactgtgtggagctgattgaggagccggacgtcgacggc
ttcctcatcggaggtgccgccctcgacgtcgatgagctcaccacaatctgcaggaagacg
attgcgacaacatcttcacatgataatagttga

DBGET integrated database retrieval system