KEGG   Bifidobacterium animalis subsp. lactis BB-12: BIF_01928Help
Entry
BIF_01928         CDS       T01840                                 

Definition
(GenBank) Cold shock protein
  KO
K03704  
cold shock protein (beta-ribbon, CspA family)
Organism
bbb  Bifidobacterium animalis subsp. lactis BB-12
Brite
Transcription factors [BR:bbb03000]
 Prokaryotic Type
  Other transcription factors
   Others
    BIF_01928
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1406237..1406449
Genome map
AA seq 70 aa AA seqDB search
MPRGTVKFFNVGRGYGFITPEDGGADVFVHYSSIEAEGFKALRQGDLVEYDSKPTDKGEL
ATRVVKIHRS
NT seq 213 nt NT seq  +upstreamnt  +downstreamnt
atgccaaggggaacggttaaattcttcaatgtaggtcgcgggtacgggttcattactccc
gaggatggtggggcggatgtgttcgtacattattcctccatcgaggccgagggtttcaag
gcgcttcgccagggggatttggtggagtacgacagcaagcccactgacaagggtgaactt
gccacgagggtggtcaagattcatcgttcctga

DBGET integrated database retrieval system