KEGG   Bifidobacterium animalis subsp. lactis BB-12: BIF_02065Help
Entry
BIF_02065         CDS       T01840                                 

Definition
(GenBank) Aspartyl-tRNA synthetase
  KO
K01876  
aspartyl-tRNA synthetase [EC:6.1.1.12]
Organism
bbb  Bifidobacterium animalis subsp. lactis BB-12
Pathway
Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:bbb00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    BIF_02065
Enzymes [BR:bbb01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.12  aspartate---tRNA ligase
     BIF_02065
Amino acid related enzymes [BR:bbb01007]
 Aminoacyl-tRNA synthetase
  Class II (A)
   BIF_02065
Transfer RNA biogenesis [BR:bbb03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    BIF_02065
 Prokaryotic Type
   Other AARSs
    BIF_02065
Mitochondrial biogenesis [BR:bbb03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    BIF_02065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1419544..1421475)
Genome map
AA seq 643 aa AA seqDB search
MHSRGNRILCMPSKPFPSMPTTVEKSAFRTVLSKNNAMENRGSMSQQTAYRTHHATDVTE
VLVGEHVTLAGWVDRRRDHGGVAFIDLRDNTGLVQVVINEEEMARPLRSEYVIEVDGKVR
QRPEGNENDHLATGKVEVVAEKIRVLAKSDALPFQVSTALENESENKLPGEDVRLKYRYL
DLRRPAMQRNIKLRSDMMRAARTELDKLGFTEVETPTMIKSTPEGARDFVVPARLVPGSW
YALPQSPQLLKQLLMVAGVERYYQFARCYRDEDFRADRQPEFTQLDMEMSFVDQEDVIAM
AEQVIKAIWKADGYDIETPIRRIPWQEAMDKYGSDKPDLRFGNELIELTDYFKNTPFRVF
QAPYVGAVLFKGGASTPRRQFDAWQDWAKQRGAKGLAYVVFGENGELKGPVAKNLSGEER
NGLKEAVGAEDGDAVFFAAGARESSQLLLGAVRVELANRAGLLDPKKFAFCWVVDFPLFK
RTDDPDDDDVAVGHSKWTSMHHPFTMPSKDWIDTFDEDPEHAMSDSYDIVCNGNEMGGGS
VRIHRDDIQDRVLNVLGITPQEAQDKFGFLLEAFKYGAPPHAGIALGWDRTVALLAGADS
IRDVIAFPKAGGGRDPLTGAPAPISDEQRAETGVDYDPEEDED
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
atgcacagtcgtggcaaccggatactgtgtatgcccagcaaaccgtttccatcaatgccg
acaaccgttgaaaaatcggcgttcagaacagttttatccaagaacaatgcaatggagaat
agaggaagcatgagccagcagacggcttatcgtacacatcacgccaccgacgtgaccgaa
gttctggtcggcgagcacgtcacgcttgccggttgggtggaccgccgccgtgatcatggc
ggcgtggccttcatcgatctgcgtgacaacaccggtctggtgcaggtggtcatcaacgag
gaggagatggctcgtccgctgcgcagcgaatatgtgatcgaggtggacggcaaggttcgc
cagcgtccggagggcaacgagaacgaccatctggcgacaggcaaggtcgaggtcgtggcc
gagaagatccgcgtgctcgcaaagtccgacgcgctgcctttccaggtgtccaccgcactc
gaaaacgaatccgagaacaagctgccgggtgaggatgtgcgtctcaagtaccgctacctc
gatctgcgacgcccggccatgcagcgcaacatcaagctgcgttccgacatgatgcgcgcc
gcccgcaccgagctcgacaagctcggcttcaccgaggtcgagaccccgacgatgatcaag
tcgacacccgagggcgcccgtgacttcgttgtcccggcacgtctggttcccggttcctgg
tatgcgctcccccagtccccgcagctgctcaagcagctgctcatggtggccggtgtcgaa
cgttactaccagttcgcccgctgctatcgcgacgaggatttccgcgcagaccgtcagccc
gagttcacccagctcgacatggagatgagcttcgtggaccaggaggatgtcatcgccatg
gccgaacaggtgatcaaagccatctggaaggccgatggatacgacattgagacgccgatc
cgtcgcatcccatggcaggaggccatggacaagtatggctccgacaagcctgatctgcgc
ttcggaaacgagctcatcgaactcaccgattatttcaagaacacgccgttccgcgtgttc
caggccccatacgtgggcgcggtgctcttcaagggcggcgcctccactccccgtcgccag
ttcgacgcctggcaggattgggccaagcagcgtggtgccaagggtcttgcgtacgtcgtg
ttcggcgagaatggagagctcaagggacctgtcgcaaagaacctctccggcgaggaacgc
aatgggctcaaggaagctgtgggtgccgaggatggcgatgccgtgttcttcgcagcaggt
gcccgcgaatcctcccagttgctgctcggtgccgtacgcgtcgaactcgccaaccgcgcc
ggtctgctcgacccgaagaaattcgcattctgctgggtggtcgacttcccgctgttcaag
cgcaccgacgacccggacgacgacgacgttgcagtcggccattccaagtggacgtcgatg
caccacccgttcacaatgccgtcgaaggactggatcgacaccttcgatgaggatcccgag
catgcgatgagcgattcctacgacatcgtgtgcaacggtaatgaaatgggcggcggctcg
gtgcgtatccaccgtgacgacattcaggaccgcgtactcaatgtgcttggcatcacgcct
caggaggctcaggataagttcggcttcctgctggaggcattcaagtacggcgcgccgccg
cacgcaggcattgcactcggctgggaccgcacggttgccctgctcgccggcgcggattcg
attcgcgatgtcatcgccttcccgaaggccggtggcggtcgcgatccactgacaggcgca
cctgcaccgatttccgacgaacagcgtgcggaaaccggcgtggattacgatccggaagag
gatgaggactga

DBGET integrated database retrieval system