KEGG   Bifidobacterium animalis subsp. lactis BB-12: BIF_02090Help
Entry
BIF_02090         CDS       T01840                                 

Definition
sucrose phosphorylase (EC:2.4.1.7)
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
bbb  Bifidobacterium animalis subsp. lactis BB-12
Pathway
Starch and sucrose metabolism
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:bbb00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
790116..791636
Genome map
AA seq 506 aa AA seqDB search
MKNKVQLITYADRLGDGNLASMTDILRTRFDGVYEGVHILPFFTPFDGADAGFDPIDHTK
VDARLGDWDDIAELAKTHDIMVDAIVNHMSWQSKQFQDVLANGEDSEYYPMFLTMSSVFP
DGATEEELAGIYRPRPGLPFTHYSFAGKTRLVWVTFTPQQVDIDTDSAKGWEYLMSIFDQ
MSKSHVKYIRLDAVGYGAKEAGTSCFMTPKTFELISRLREEGAKRGLEILIEVHSYYKKQ
VEIAAKVDRVYDFALPPLLLHSLFTGKVDALAHWTEIRPNNAVTVLDTHDGIGVIDIGSD
QLDRSLKGLVPDADVDNMVETIAKNTHGESKAATGAAASNLDLYQVNSTYYSALGCNDQH
YIAARAVQFFLPGVPQVYYVGALAGENDMELLKRTNVGRDINRHYYTTSEIDKNLERPVV
KALNALARFRNELPAFDGDFSYSVGDDESIAFSWNGFGSSATLTFTPSKGMGVENPQSVA
TLVWTDSTGEHRTDDLIANPPVMQAS
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgaagaacaaagttcagctgatcacctatgcggatcgcttgggtgacggcaaccttgct
tcgatgaccgacattctgcgcacgcgattcgacggcgtgtacgagggcgtgcacattctg
ccgttcttcaccccgttcgatggcgcggacgcaggcttcgacccgatcgaccacaccaag
gtcgacgcccgcctcggtgactgggatgacatcgccgagctcgccaagacgcatgacatc
atggtcgatgccatcgtcaaccacatgagctggcagtccaagcagttccaggatgtgctc
gcgaacggcgaggattccgagtactacccgatgttcctcacgatgagctccgtgttcccc
gacggcgcgaccgaggaggagctcgccggcatctaccgcccgcgcccgggcctgccgttc
acccactacagcttcgccggcaagacccgcttggtgtgggtcacgttcacgccgcagcag
gtcgacattgacaccgactccgccaagggctgggaatacctgatgtcgatcttcgaccag
atgagcaagtcgcacgtcaagtacattcgcctcgacgccgtcggctacggcgccaaggag
gccggcaccagctgcttcatgacccccaagaccttcgaactcatctcgcgactgcgcgag
gagggtgccaagcgcggtctggagattctcatcgaggtgcactcgtactacaagaagcag
gtggagatcgccgccaaggtggatcgcgtctatgacttcgcgctgccgccattgctgctg
cactcgctgttcaccggcaaggtggacgcgctcgcgcactggaccgagattcgcccgaac
aatgcggtcaccgtgctcgacacgcacgacggcatcggcgtcatcgacatcggctccgac
cagctcgaccgttcgctcaagggtctggtgcccgacgcggacgtcgacaacatggtcgag
acgatcgcgaagaacacccatggcgagtcgaaggccgcaaccggcgccgccgcttcgaac
ctcgacctctaccaggtgaactccacatattattcggcgctcggctgcaatgaccagcat
tacattgccgcacgcgccgtgcagttcttcctgccgggcgttccgcaggtgtactatgtg
ggcgcgctcgccggcgagaacgacatggagctgctcaagcgcacgaatgtgggccgcgac
atcaaccgccactattacacgacctccgagatcgacaagaacctcgaacgtccggtggtc
aaggccctgaacgcgctcgccagattccgcaacgagctgccggcgttcgacggcgacttc
agctactcggtgggcgatgacgagtcgattgcgttctcctggaacggtttcggatcctcc
gctacgctcacgttcacgccgtccaagggcatgggtgtcgagaacccacagtccgtcgcc
acgctcgtctggacggattccactggcgagcaccgcaccgacgacctcattgcgaacccg
cccgtcatgcaggcgagctga

DBGET integrated database retrieval system