KEGG   Bifidobacterium animalis subsp. lactis BB-12: BIF_02099Help
Entry
BIF_02099         CDS       T01840                                 

Definition
(GenBank) Alcohol dehydrogenase
  KO
K04072  acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
bbb  Bifidobacterium animalis subsp. lactis BB-12
Pathway
bbb00010  Glycolysis / Gluconeogenesis
bbb00071  Fatty acid degradation
bbb00350  Tyrosine metabolism
bbb00620  Pyruvate metabolism
bbb00625  Chloroalkane and chloroalkene degradation
bbb00626  Naphthalene degradation
bbb00650  Butanoate metabolism
bbb01100  Metabolic pathways
bbb01110  Biosynthesis of secondary metabolites
bbb01120  Microbial metabolism in diverse environments
bbb01130  Biosynthesis of antibiotics
bbb01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bbb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BIF_02099
   00620 Pyruvate metabolism
    BIF_02099
   00650 Butanoate metabolism
    BIF_02099
  Lipid metabolism
   00071 Fatty acid degradation
    BIF_02099
  Amino acid metabolism
   00350 Tyrosine metabolism
    BIF_02099
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BIF_02099
   00626 Naphthalene degradation
    BIF_02099
Enzymes [BR:bbb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BIF_02099
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     BIF_02099
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Aldedh Fe-ADH_2
Motif
Other DBs
NCBI-ProteinID: ADC85399
UniProt: D3R3S5
Position
1098960..1101779
Genome map
AA seq 939 aa AA seqDB search
MRQLTSREICATGRTDLPNLQEVRMADKNSAETATKAAKLAVNVEDKKAAAQAEVDALVR
KAQKALAEFEKLDQQAVDRIVAKASVAALNKHLVLAKLAVDETGRGLVEDKATKNIFACE
HVTNYMAGQKTVGIIREDDVLGIDEVAEPVGVVAGVTPVTNPTSTAIFKSLIALKTRCPI
VFGFHPGAQKSSVEAARIVRDAAIEAGAPENCVQWIEHPSIEATGALMQHPGVATILATG
GPGMVKAAYSSGKPALGVGAGNAPAYVDNNVDVQRVANDLILSKHFDYGMICATEQAIIA
HKDIYAPLVKELKRRKAYFVNDEEKAKLEKYMFGCTAFSGETPKLNSVVPGKSPQYIAHE
AGFEIPEDATILAAECSEVGENEPLTMEKLAPVHAVLKFSDKEQGFEMCEEMLKHGAGHT
AAIHTNNDDLVREYGLRMHACRIIWNQPSSLGGIGDIYNSIAPSLTLGCGSYGGNSVSGN
VQAINLLNIKRIARRNNNMQWFKIPAKTYFEPNAIKYLRDMYGIERAVIVCDKVMEQLGI
VDKVIDQLRARSNRVTFRIVDYVEPEPSVETVERGAAMMRDEFEPDTIIAVGGGSPMDAA
KIMWLLYEHPEIAFSDVREKFFDIRKRAFKIPPLGTKAKLVCIPTSSGTGSEVTPFAVIT
DHKTGYKYPITDYALTPSVAIVDPVLARTQPRRLASDAGFDALTHSMEAYVSVYANDFTD
GMALHACKLIWDNLAESVNSEPGETKKKAQEKMHNAATMAGMAFGSAFLGMCHAMAHTIG
ALCHIAHGRTNSILLPYVIRYNGQVPEEPTSWPKYSKYIAPERYQELASLLGVDPGKTPA
EGVENLAKAVEDYRDNKLGMNKSFKDCGVDEDYFWSILEQIGMRAYEDQCAPANPRIPQI
QDMMDIAIAAYYGVSQAEGHAMRVEREGVGATEEASERV
NT seq 2820 nt NT seq  +upstreamnt  +downstreamnt
gtgagacaactcacatctcgtgaaatctgcgccacggggcgcaccgatttgccgaatcta
caggaggttcgcatggcagacaagaacagcgccgagaccgcaacgaaggcggccaagctt
gctgtgaatgtggaagacaagaaggccgcggcacaggccgaggtcgacgctctggtcagg
aaggcgcagaaggcgctggcggaattcgaaaagctcgatcagcaggccgtcgatcgcatc
gtggcgaaggcctccgtggccgccctcaacaagcatctggtgctggcgaaactggcagtc
gacgagaccggtcgtggactcgtcgaagacaaggcgacgaagaacatcttcgcctgcgag
cacgtgaccaattacatggccggtcagaaaaccgtcggcatcatccgcgaagacgacgtg
ctcggcatcgacgaagtggcagaaccggtcggcgtcgtcgcaggcgtcaccccggtgacc
aacccgacgtccactgccatcttcaagtcgctcatcgccctcaagacccgttgcccgatt
gtcttcggcttccacccgggagcgcagaagagctccgtcgaagcggcgcgcatcgtgcgt
gacgccgccatcgaggcaggtgccccggagaactgcgtgcagtggatcgaacacccgtcc
atcgaggcgaccggcgcgctcatgcagcatcccggcgtggccacgatcctcgcgaccggc
ggccccggcatggtcaaggccgcgtactcgtccggcaagccggccctgggcgtcggcgcc
ggcaatgccccggcctacgtcgacaacaacgtcgacgtgcagcgcgtggcgaacgacctc
atcctctcgaagcacttcgactacggcatgatctgcgccaccgagcaggcgatcatcgcg
cacaaggacatctacgcaccgctcgtcaaggaattgaagcgccgcaaggcatacttcgtc
aacgacgaggagaaggccaagctcgagaagtacatgttcggctgcaccgcgttctccggc
gagaccccgaagctcaactccgtggtcccgggcaagtctccgcagtacatcgcgcacgaa
gccggcttcgaaatccccgaggacgccacgatcctcgctgccgaatgctccgaggtgggc
gagaacgagccgctcaccatggagaagctggcgccggtgcacgccgtgcttaagttctcc
gacaaggagcagggcttcgaaatgtgcgaggagatgctcaagcacggtgccggccatacc
gccgcaatccacacgaacaacgacgacctcgtccgcgagtacggcctgcgcatgcacgcc
tgccgcatcatctggaaccagccgagctcgctcggcggcattggcgacatctacaactcc
atcgccccgtcgctcacgctgggctgcggttcctacggtggcaactccgtctccggcaac
gtgcaggcgatcaatctgctcaacatcaagcgaatcgcgcgaaggaacaacaacatgcag
tggttcaagatcccggcaaagacgtacttcgagccgaacgccatcaagtacctgcgcgac
atgtatggcatcgagcgtgccgtcatcgtgtgtgacaaggtgatggagcagctcggcatc
gtcgacaaggtgattgaccagctgcgtgcacgctccaaccgagtcaccttccgcatcgtc
gactatgtggagcccgagccgagtgtcgagaccgtcgagcgcggcgccgccatgatgcgc
gacgaattcgagccggacacgatcatcgccgtcggcggtggctctcccatggacgccgcg
aagatcatgtggctgctctatgagcacccggaaatcgcgttctccgacgtgcgtgagaag
ttcttcgacattcgcaagcgcgctttcaagattccgccgctcggcaccaaggccaagctt
gtgtgcatcccgacctcgtcgggcaccggctccgaggtcacgccgttcgctgtgatcacc
gaccacaagaccggctacaagtacccgatcaccgactacgcgctcacgccgtccgtcgcg
atcgtcgacccggtgctcgcgcgcacgcagccgcgccgactggcctccgatgccggcttc
gatgcgctgacccattcgatggaggcctacgtctccgtctatgcgaacgacttcaccgac
ggtatggcgctgcatgcctgcaagctgatctgggacaaccttgcggagtccgtcaatagc
gagccgggcgaaaccaagaagaaggcgcaggagaagatgcacaacgccgccaccatggcc
ggcatggcattcggatccgccttcctcggtatgtgccacgccatggcgcacaccatcggc
gccctgtgccacatcgcgcacggccgcacgaactcgattctgctgccatatgtgatccgc
tacaacgggcaggtgccggaggagccgacctcctggccgaagtacagcaagtacatcgcg
ccggagcgttaccaggagctcgcctcgctgctcggggtcgacccaggcaagaccccggcc
gagggtgtcgagaatctggcgaaggccgtcgaggactaccgcgacaataagctcggcatg
aacaagagcttcaaggattgcggtgtggatgaggactacttctggagcatcctcgagcag
atcggcatgcgcgcctatgaagaccagtgcgcgcctgcgaatccgcgcatcccgcagatc
caggacatgatggatatcgccatcgccgcctactacggcgtctcgcaggcggagggccat
gcgatgcgcgttgagcgcgaaggcgtgggcgccacggaggaagcctccgagcgcgtctga

DBGET integrated database retrieval system