KEGG   Bifidobacterium animalis subsp. lactis BLC1: BLC1_0047Help
Entry
BLC1_0047         CDS       T01841                                 

Definition
beta-galactosidase
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
bbc  Bifidobacterium animalis subsp. lactis BLC1
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:bbc00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    BLC1_0047
Enzymes [BR:bbc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     BLC1_0047
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(55233..57338)
Genome map
AA seq 701 aa AA seqDB search
MARAYTDPILFGAAYYDEYIPRDLDRIDTDMEMMTRAGINVIRIGESTWSTCEPQPGHFD
WTHIDRALDAATNAGINVIVGTPTYAVPTWLVAMYPDVLATTPAGEPHYGARQIMNIVNP
AYRLYGERVIRSLISHVAQQPCVIGYQVDNETKYYDSVSHDMQVMFIKQLRHEFKNDLEA
LNEAYGLDYWSNRINAWEDFPDLTGSINESLRARFDRFRRDQVAEYLAWQASIIREYMRD
DQFITHNFDYEWRGHSYGLQPAVDHFRAARALDICGVDIYHPSEDALTGKEIAFGGDMAR
SAGGGNYLVLETQAQGQHGWLPYPGQLRLQAYSHLASGADGIMYWHWHSIHNSFETYWRG
LLSHDFESNPTYEEAGRFGREIGDPRIGDTLSHLSKRNAVAILASNESLTALSWFHIETG
FPMGGTLTYNDVLRSIYDALFELNVEVDFLPADASADQLAGYSLVIAPALYTTDQQTIDR
LARYVKNGGHLLATMRSFVADENVKVWHDKAPHHLVDIFGMTYNQFTRPMGVSLKCPDTL
ADLAGASANDFIEMLSPAPETHVLAWYDHYAWDSYAAITRHAFGSGDAQWVGTQLQADAW
RTVLAEALSNAGVHTPGMELAGTVCVRSGTNTAGDTVTYLLNYSGSPITFRAPASGTFLL
GHPTDDGEQAVTAETPVTVGDAVTLPRWGVDIIVGRQPTMN
NT seq 2106 nt NT seq  +upstreamnt  +downstreamnt
atggcccgcgcatacaccgaccccattctgttcggcgcagcatactatgatgaatacatc
ccgcgcgatctggatcgcattgacaccgacatggagatgatgacccgagcgggcatcaac
gtcattcgcatcggcgaatccacgtggtccacatgcgaaccccagcccgggcatttcgac
tggacgcacatcgaccgcgcgctcgacgcggcgaccaacgccggaatcaacgtgattgtg
ggaaccccgacctatgcggtacccacatggctcgtcgccatgtatccggacgtccttgcc
accacaccggccggggaaccccactacggggcgcggcaaatcatgaacatcgtcaacccg
gcctaccgcctttacggcgagagggtgatccgatccctcatctcccacgtggcacagcag
ccttgcgtcatcggctatcaggtagacaatgagacgaaatactacgattccgtctcccac
gacatgcaggtgatgttcatcaaacaactacgccacgaattcaagaacgacctcgaggca
ttgaacgaggcgtacggcttggattactggtcgaatcggatcaatgcgtgggaggacttc
ccggatctcaccggttcgatcaacgagtcgttgcgcgcgcgattcgacaggttccgccgc
gatcaagtggcggagtatcttgcatggcaggcgagcattattcgggagtatatgcgcgac
gaccagttcatcactcataatttcgattacgaatggcgcggtcattcctatgggttacag
cctgcggtcgaccatttccgtgccgcccgcgcactcgacatctgcggcgtcgacatctac
catccgagcgaggatgcactcaccggcaaggagatcgcattcggcggcgacatggcacgt
tcggcaggcggcggcaattacctggtgctcgaaacgcaggcacagggtcagcatggttgg
ctgccgtacccaggccaattgcgccttcaagcctacagtcatctcgcatccggtgcggat
ggaatcatgtactggcattggcattcaattcacaattcgttcgaaacgtattggcgcgga
ctgctgtcgcacgatttcgagagcaatcccacctacgaggaggccgggaggtttggacgc
gagatcggcgacccgcgtatcggagacacgctcagtcatctgtcaaaacgcaatgcggtg
gcaatcctcgccagcaacgagtcgctcaccgcgctgtcctggttccacatcgaaacggga
ttccccatgggcggcacgctcacatacaacgacgtgttgcgatccatatacgatgcattg
ttcgagctcaatgtggaggtcgatttcctgcccgcagatgcgagcgcagaccaactcgcc
ggttactccctggtgatcgcacccgcattgtataccacggatcagcagaccatcgaccga
ttggcgcggtatgttaagaatggcggtcatctgctcgccaccatgcggtcattcgttgcg
gacgagaacgtgaaagtgtggcacgacaaggcaccgcatcatcttgtcgacatatttggc
atgacctacaaccagttcactcgtccgatgggtgtatcgctcaaatgccccgacactttg
gccgacctcgccggcgcgtctgcaaacgacttcatcgagatgctctccccggctccggaa
acccacgtactcgcttggtacgaccattatgcctgggattcatatgcggcgatcaccaga
catgcattcggttccggagatgcgcagtgggtgggcacgcagcttcaggcggatgcatgg
cgcaccgtgcttgcagaggccctgtccaacgccggcgtgcacacccccggcatggaactg
gccggcacagtctgcgtgcggagcggaaccaacacggcaggcgataccgttacctacctg
ctcaactattcagggtcgcccatcaccttccgggcacccgcctcgggaacgttcctgctg
ggacatcccacagacgacggagagcaggccgtcaccgccgaaactccggtgaccgtgggc
gatgccgtcacattgccgcgttggggagtggacatcattgtcggccggcaacccacaatg
aattga

DBGET integrated database retrieval system