KEGG   Bifidobacterium animalis subsp. lactis BLC1: BLC1_0203Help
Entry
BLC1_0203         CDS       T01841                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
bbc  Bifidobacterium animalis subsp. lactis BLC1
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bbc00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BLC1_0203
DNA repair and recombination proteins [BR:bbc03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      BLC1_0203
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
247654..248256
Genome map
AA seq 200 aa AA seqDB search
MALAYDGAIQRLIDSFASLPGIGPKGAQRIAFYLLQAPDAESQRLVDAINEVKEKVRFCE
VCGNVCESSPCTICSDPRRDHGTICVVEEPKDVMSIERTREYRGLYQVLGGAINPMANVG
PSDLNIAQLLNRLHDGEVKEIIVALNPNIEGEATTTYLSRLLAPLDIKVTRLASGLPVGG
DLEYADEITLSRALEGRREV
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggcattggcatacgacggcgccatccagcggctcatcgactcgtttgcgagtctgccg
ggcatagggcccaaaggagcgcaacgcatcgccttctatctgctgcaggcgccggatgcg
gagtcgcagcgcctcgtcgacgcaatcaacgaggtgaaggagaaagtacggttctgcgaa
gtctgcgggaatgtgtgcgaaagcagcccgtgcacaatctgctcggatccgcgtcgtgat
cacggcacgatctgcgtggtggaggagccgaaggacgtcatgagcatcgaacgcacgcgc
gaataccgcgggctctaccaggtgctgggcggcgccatcaacccgatggccaacgtcggc
ccgagcgacctcaacatcgcgcagctgctcaacagactccacgacggcgaggtcaaggag
atcatcgtggcgctcaatccgaacatcgagggggaggcaaccaccacctacctgagccgc
ctgctcgcgccgctcgacatcaaggtgacgcgtctggcgagcggtctgccggtgggcggc
gacctcgagtacgccgacgaaatcacgttgtctcgcgcgctcgaagggcgtcgtgaggtg
tga

DBGET integrated database retrieval system