KEGG   Bifidobacterium animalis subsp. lactis BLC1: BLC1_0235Help
Entry
BLC1_0235         CDS       T01841                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
bbc  Bifidobacterium animalis subsp. lactis BLC1
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bbc00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BLC1_0235
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BLC1_0235
Enzymes [BR:bbc01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     BLC1_0235
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
293221..294543
Genome map
AA seq 440 aa AA seqDB search
MEKTDDVLHVVGGKPLNGTIKVRGAKNFVSKAMVAALLAPGTSVLKNVPEIRDVHVVSDL
LRLHGVNVDVNGDEGIVTIDAKNVQLADVADVDTLSGSSRIPILFSGPLLHRLGEAFIPA
LGGCNIGGRPIDFHLETLRKLGATVDKEHKDGIHITAPNGLHGAKIHLPYPSVGATEQTL
LAAVLADGKTELSGAATEPEIMDLVAVLQKMGAIISVDVDRTFRIEGVKELKGYTHTALT
DRIEAASWASAALATHGDVFVKGATQPEMMTFLNVFRKIGGEFDITDRGIRFWHPGGDLK
PVAIETDVHPGFMTDWQQPLVVALTQANGLSIVHETVYENRFGFTKPLVEMGATVQLYRE
CLGSLPCRFQQRNYKHSAVIFGPTPLEGRDIDVPDLRGGFSHLIAALAAKGPSDVRGISL
IDRGYADFRGKLTALGAQID
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
gtggagaaaactgacgacgtactgcatgtggtgggcggcaagccgctcaacggcacgatc
aaggtgcgcggtgcgaagaacttcgtaagcaaggccatggtggcggctctgctcgcgccg
gggacgtcggtgctcaaaaacgtgcccgaaatacgagacgtgcatgtggtttcggatctg
ctgcgtctgcacggcgtgaacgtggacgtgaacggcgacgagggcattgtgacgatcgac
gcgaagaacgtgcagctggccgacgtggccgatgtagacacgctctccggctcgtcgcgc
attccgatcctgttctcgggcccgctgctgcaccggctgggcgaggcgttcatcccggcg
ctcggcggctgcaacattggcggccggccgatcgacttccatttggagacactgcgcaaa
ctcggcgccaccgttgacaaggaacacaaggacggcattcacatcaccgcgccgaacggt
ctgcacggcgcgaagatccacctgccgtacccgtcggtgggcgcgaccgagcagactctg
ctcgccgccgtgctcgcagatggcaagaccgagctgtccggcgcggcgaccgaaccggag
atcatggacttggtggccgtgctgcagaagatgggcgcgatcatctcggtggacgtggac
cgcacgttccgcatcgagggcgtgaaggagctgaagggctacactcacacggctctcacc
gaccgcattgaggcggcgtcgtgggcgtcggccgcgctcgccacacacggcgacgtgttc
gtgaagggcgcgacgcagccggagatgatgacgttcctcaatgtgttccgcaaaatcggc
ggcgagttcgacatcaccgaccgcggcatccgcttctggcacccgggcggcgacctgaag
ccggtggcgatcgagaccgacgtgcaccccggcttcatgaccgactggcagcagccgctc
gtcgtggcgctcacgcaggcgaacgggctgagcattgtgcatgagaccgtgtacgagaac
cgtttcggtttcacgaagccgctggtggagatgggcgcaaccgtgcagctctaccgcgaa
tgcctcggctcgttgccgtgccgcttccagcagcgcaactacaagcattccgctgtgatc
ttcgggccgacgccgctcgaagggcgcgacatcgacgtgccggatctgcgcggtggattc
agccacctgatcgcggcgctggcggcgaagggaccgtccgacgtgcgcggcatcagcctg
atcgaccgcgggtacgcggacttccgcggcaagctcacggcgctcggcgcgcagatcgac
tag

DBGET integrated database retrieval system