KEGG   Bifidobacterium animalis subsp. lactis BLC1: BLC1_0293Help
Entry
BLC1_0293         CDS       T01841                                 

Definition
glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
bbc  Bifidobacterium animalis subsp. lactis BLC1
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:bbc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BLC1_0293
  Amino acid metabolism
   00330 Arginine and proline metabolism
    BLC1_0293
Enzymes [BR:bbc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     BLC1_0293
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
375076..376209
Genome map
AA seq 377 aa AA seqDB search
MQTPSQEEVRRAVAAARTVVVKVGSSSLTQPSGHLDVDKLNALVGAIAQVRMLGGNIVLV
SSGAIAAGFGPLGFESRPTDVATQQATASVGQGLLMAQYEMAFGRYGIRVGQLLITAEDT
MQPRQYRNARRTMAKLLELGVVPIVNENDALASNEIRFGDNDRLSALIANMVRADALILL
TDVDALYTAPPSEPGSHRIGFVPNITELLDQVRVGGSESGVGTGGMVTKLEAARMAAVSG
IPAVLTAARNAGPALMGDEVGTAFAPVKQRGSARRLWIKFAAHPRGVLVADSGAAKAVRG
GRASLLAAGVLESRGDFAAGDPVWIDDEAGNHLARGLAGYDSEEIPNMLGRNTAQLRRLL
GEEYAHPLVHRDNLVLV
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgcagaccccgtcccaggaggaagtacgccgggcggtggcagccgcgcgaaccgtggtg
gtgaaggtggggtcgagctcgctcacgcagccgtccgggcacttggacgtagacaagctc
aatgcgctggtgggcgcgatcgcgcaggtgcgcatgctcggcggcaacatcgtgctcgtc
tcgtccggcgccatcgccgcgggtttcggtccgctcggcttcgaatcgcgccccaccgat
gtggccacacagcaggcgaccgcgtcggtggggcaggggctgctcatggcccagtacgag
atggcgttcggccgctacggcattcgcgtgggccagctgctcatcaccgccgaagacacg
atgcagccacggcagtaccgcaatgcgcggcgcaccatggccaagctgctcgaactcggt
gtggtgccgatagtcaacgagaacgatgcgcttgccagcaacgagatccgtttcggcgac
aacgaccggctttccgcgctcatcgcgaacatggtgcgtgccgacgcgctgattctgctc
accgatgtcgacgcgctctacaccgcacccccaagcgaaccgggctcccatagaatcggc
ttcgtgccgaacatcaccgaactgctcgatcaggtgcgtgtgggcggttcagagtcgggc
gtgggcaccggcggtatggtcacgaagctcgaggccgcgcgcatggccgccgtctccggc
attccggccgtgctcaccgccgcccgcaacgccggtccggcactcatgggcgatgaggtg
ggcacggcattcgctccggtgaagcaacgcggttcggcgcgcaggttgtggatcaaattc
gcggcccatccgcgtggagtgctcgtggccgattccggcgcggccaaggcggtgcgcggc
ggacgggcgagtctgcttgctgcgggtgtgctcgaatcgcgtggtgatttcgccgccggc
gacccggtgtggatcgacgacgaggcgggcaatcatctggcgcgcggccttgccggttac
gattccgaggagattccgaatatgctcggacgcaacaccgcacagctgcgccgcctgctt
ggcgaggaatatgcgcacccgctcgtgcaccgcgacaatctcgtgctcgtgtga

DBGET integrated database retrieval system