KEGG   Bifidobacterium animalis subsp. lactis BLC1: BLC1_0293Help
Entry
BLC1_0293         CDS       T01841                                 

Definition
glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
bbc  Bifidobacterium animalis subsp. lactis BLC1
Pathway
Arginine and proline metabolism
Carbapenem biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:bbc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BLC1_0293
  Amino acid metabolism
   00330 Arginine and proline metabolism
    BLC1_0293
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    BLC1_0293
Enzymes [BR:bbc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     BLC1_0293
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
375076..376209
Genome map
AA seq 377 aa AA seqDB search
MQTPSQEEVRRAVAAARTVVVKVGSSSLTQPSGHLDVDKLNALVGAIAQVRMLGGNIVLV
SSGAIAAGFGPLGFESRPTDVATQQATASVGQGLLMAQYEMAFGRYGIRVGQLLITAEDT
MQPRQYRNARRTMAKLLELGVVPIVNENDALASNEIRFGDNDRLSALIANMVRADALILL
TDVDALYTAPPSEPGSHRIGFVPNITELLDQVRVGGSESGVGTGGMVTKLEAARMAAVSG
IPAVLTAARNAGPALMGDEVGTAFAPVKQRGSARRLWIKFAAHPRGVLVADSGAAKAVRG
GRASLLAAGVLESRGDFAAGDPVWIDDEAGNHLARGLAGYDSEEIPNMLGRNTAQLRRLL
GEEYAHPLVHRDNLVLV
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgcagaccccgtcccaggaggaagtacgccgggcggtggcagccgcgcgaaccgtggtg
gtgaaggtggggtcgagctcgctcacgcagccgtccgggcacttggacgtagacaagctc
aatgcgctggtgggcgcgatcgcgcaggtgcgcatgctcggcggcaacatcgtgctcgtc
tcgtccggcgccatcgccgcgggtttcggtccgctcggcttcgaatcgcgccccaccgat
gtggccacacagcaggcgaccgcgtcggtggggcaggggctgctcatggcccagtacgag
atggcgttcggccgctacggcattcgcgtgggccagctgctcatcaccgccgaagacacg
atgcagccacggcagtaccgcaatgcgcggcgcaccatggccaagctgctcgaactcggt
gtggtgccgatagtcaacgagaacgatgcgcttgccagcaacgagatccgtttcggcgac
aacgaccggctttccgcgctcatcgcgaacatggtgcgtgccgacgcgctgattctgctc
accgatgtcgacgcgctctacaccgcacccccaagcgaaccgggctcccatagaatcggc
ttcgtgccgaacatcaccgaactgctcgatcaggtgcgtgtgggcggttcagagtcgggc
gtgggcaccggcggtatggtcacgaagctcgaggccgcgcgcatggccgccgtctccggc
attccggccgtgctcaccgccgcccgcaacgccggtccggcactcatgggcgatgaggtg
ggcacggcattcgctccggtgaagcaacgcggttcggcgcgcaggttgtggatcaaattc
gcggcccatccgcgtggagtgctcgtggccgattccggcgcggccaaggcggtgcgcggc
ggacgggcgagtctgcttgctgcgggtgtgctcgaatcgcgtggtgatttcgccgccggc
gacccggtgtggatcgacgacgaggcgggcaatcatctggcgcgcggccttgccggttac
gattccgaggagattccgaatatgctcggacgcaacaccgcacagctgcgccgcctgctt
ggcgaggaatatgcgcacccgctcgtgcaccgcgacaatctcgtgctcgtgtga

DBGET integrated database retrieval system