KEGG   Bifidobacterium animalis subsp. lactis BLC1: BLC1_0601Help
Entry
BLC1_0601         CDS       T01841                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
bbc  Bifidobacterium animalis subsp. lactis BLC1
Pathway
bbc00230  Purine metabolism
bbc01100  Metabolic pathways
Module
bbc_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:bbc00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    BLC1_0601
Enzymes [BR:bbc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     BLC1_0601
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 AAA_16 CPT AAA_33
Motif
Other DBs
NCBI-ProteinID: AEN76379
Position
739986..740615
Genome map
AA seq 209 aa AA seqDB search
MSEQSRQSQATERQGGRLIVLTGPTAVGKGTVETALRKAHPEVWVSVSATTRDPRPGERD
GVNYWFISEPEFLRRQEAGEFLETAVVHGMAHYGTPLEPVREHLAGNVPTILEIDLQGAR
RVKERAKELGLDVVYVFIAPPSFDELKKRLIGRGTETPEQQAKRLETAKVELAAEPEFDV
TIVNEQVDKAARDLWNVIAQEYGLPQDTD
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaacaatcccggcaatcgcaggcaaccgagcggcaaggcggccggctgatcgta
ctcaccggccccacagccgtgggcaagggcaccgtcgagacggcgttacgcaaggcgcat
ccggaggtctgggtttcggtctccgccaccacgcgcgatccacggccgggggaacgcgat
ggcgtgaactactggttcataagcgaacccgaattcctgcgcaggcaggaggcgggggag
ttcctcgaaaccgccgtcgttcatggcatggcgcactacggcacgccgttggaacccgta
cgtgagcacttggcagggaacgtgccgacaatcctcgagatcgacctgcagggtgcgcgc
cgcgtcaaggagcgcgcgaaggaactcggactcgacgtggtttacgtgttcatcgcgcca
ccaagcttcgacgagctcaagaaacgtctgatcgggcgtgggacggagacgcctgaacag
caggcgaagcggctcgagaccgcgaaggtggagctggcggcggagcccgagttcgatgtg
acgatcgtgaacgagcaggtggacaaagcggcacgggacctgtggaatgtcatcgcacag
gaatacggcttgccacaggataccgactga

DBGET integrated database retrieval system