KEGG   Bifidobacterium animalis subsp. lactis BLC1: BLC1_0708Help
Entry
BLC1_0708         CDS       T01841                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
bbc  Bifidobacterium animalis subsp. lactis BLC1
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bbc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BLC1_0708
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BLC1_0708
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    BLC1_0708
Enzymes [BR:bbc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     BLC1_0708
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(871988..873475)
Genome map
AA seq 495 aa AA seqDB search
MSTFHSTRSSDEAFTSKQAIRKGIADDGGLFVTDALGETKIDISDLAGKSYQQIALTVLS
VLLDDYTEEELSQCIAEAYGSQWSDERITPVKPLGNDFIMELFNGPTCAFKDVALQILPR
LMARTTPADGDCDEKIMIVTATSGDTGKAALAGFADAQGTGITVFYPQGKVSRVQELQMT
TQQGSNVNVCAVDGNFDDAQSTVKRIFGDRDLASRLEADAHVRLSSANSINVGRLVPQVV
YYFSAYAQLLEQQVINVGDQVDFVVPTGNFGNVLAGYYAKLLGLPVRQLVVASDRNNVLF
DFLTTGTYNSKRPFFETTSPSMDILVSSNLERMLYYMSERDPRMITYLMNDLAEWGTYEV
PPEMLMEIRKVFATGWADEDQVREMIADCWDRNHYVIDPHTACGYFVMQQMPADPQVPRV
LLSTASPYKFPRVVNEALGLKADGTDFECMDELHAKSGTPIPQMLRNLENAEVRFRDCVE
VSDMGHYVEECADRL
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgagcactttccacagcacacgcagcagcgacgaggcattcacatccaagcaggcgata
cgcaagggcatcgccgacgatggcggcctgttcgtcaccgacgcccttggggagacgaag
attgacatcagcgatcttgcgggtaaaagctaccagcagattgctttgacggtgttgtcg
gtgctgcttgacgactacaccgaggaggagctttcccagtgcatcgccgaggcatacggc
tcccaatggagcgatgagcgcatcactccggtcaaaccgctgggcaacgacttcatcatg
gaattgttcaacgggccgacctgtgcgttcaaggacgtcgcgttgcagatccttccccgg
ctgatggcccgcaccactccggcggacggggattgcgatgagaagatcatgattgtcacc
gctacctctggggataccggcaaggcggcgcttgccggattcgcggatgcgcagggcacc
ggcatcacggtgttctatccgcagggcaaggtctcccgcgttcaggaactgcagatgacc
acgcaacaggggtccaatgtgaacgtatgcgcggtggatggcaatttcgatgatgcccag
tccacggtcaaacgcatcttcggcgaccgtgatctcgcgtcacgccttgaggcggacgcg
catgttcgcctttcctctgcgaattcgatcaatgtggggcgtctcgtaccgcaggtcgtc
tattatttctccgcttacgcacagctgcttgaacagcaggtgatcaatgtgggcgaccag
gtggacttcgtggtgcccaccggtaatttcggcaatgtgcttgccggatattacgccaaa
ctgctgggcctgccggtacgtcaactcgtcgtcgcctccgaccgcaacaatgtgctcttc
gacttcctcaccaccggcacctacaacagcaagcggccgttcttcgagaccacgtcgccg
tccatggacattctcgtctcctcgaatctggagcgcatgctctactacatgagcgagagg
gatccgcgtatgatcacctatctcatgaacgatctcgccgaatggggaacctacgaggtg
cctccggagatgctcatggagattcgcaaggtgttcgccaccggttgggccgatgaggat
caggtgcgcgagatgatcgccgactgctgggatcgcaaccactatgtgatcgacccgcat
accgcatgcggttatttcgtgatgcagcagatgccagcggatccgcaggtgcctcgtgtg
ctgctgtccactgccagcccgtacaagttcccgcgcgtggtcaatgaggcgcttgggctg
aaggcggatggcaccgatttcgaatgcatggacgaattgcacgccaaatcaggcacgccg
attccgcagatgctgcggaatctggagaatgccgaggtgcggttccgcgactgcgtcgag
gtgagcgacatgggccactacgtcgaggaatgcgccgaccggctatag

  All links  
No link information was found.   
DBGET integrated database retrieval system