KEGG   Bifidobacterium animalis subsp. lactis BLC1: BLC1_0708Help
Entry
BLC1_0708         CDS       T01841                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
bbc  Bifidobacterium animalis subsp. lactis BLC1
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:bbc01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:bbc00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:bbc00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(871988..873475)
Genome map
AA seq 495 aa AA seqDB search
MSTFHSTRSSDEAFTSKQAIRKGIADDGGLFVTDALGETKIDISDLAGKSYQQIALTVLS
VLLDDYTEEELSQCIAEAYGSQWSDERITPVKPLGNDFIMELFNGPTCAFKDVALQILPR
LMARTTPADGDCDEKIMIVTATSGDTGKAALAGFADAQGTGITVFYPQGKVSRVQELQMT
TQQGSNVNVCAVDGNFDDAQSTVKRIFGDRDLASRLEADAHVRLSSANSINVGRLVPQVV
YYFSAYAQLLEQQVINVGDQVDFVVPTGNFGNVLAGYYAKLLGLPVRQLVVASDRNNVLF
DFLTTGTYNSKRPFFETTSPSMDILVSSNLERMLYYMSERDPRMITYLMNDLAEWGTYEV
PPEMLMEIRKVFATGWADEDQVREMIADCWDRNHYVIDPHTACGYFVMQQMPADPQVPRV
LLSTASPYKFPRVVNEALGLKADGTDFECMDELHAKSGTPIPQMLRNLENAEVRFRDCVE
VSDMGHYVEECADRL
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgagcactttccacagcacacgcagcagcgacgaggcattcacatccaagcaggcgata
cgcaagggcatcgccgacgatggcggcctgttcgtcaccgacgcccttggggagacgaag
attgacatcagcgatcttgcgggtaaaagctaccagcagattgctttgacggtgttgtcg
gtgctgcttgacgactacaccgaggaggagctttcccagtgcatcgccgaggcatacggc
tcccaatggagcgatgagcgcatcactccggtcaaaccgctgggcaacgacttcatcatg
gaattgttcaacgggccgacctgtgcgttcaaggacgtcgcgttgcagatccttccccgg
ctgatggcccgcaccactccggcggacggggattgcgatgagaagatcatgattgtcacc
gctacctctggggataccggcaaggcggcgcttgccggattcgcggatgcgcagggcacc
ggcatcacggtgttctatccgcagggcaaggtctcccgcgttcaggaactgcagatgacc
acgcaacaggggtccaatgtgaacgtatgcgcggtggatggcaatttcgatgatgcccag
tccacggtcaaacgcatcttcggcgaccgtgatctcgcgtcacgccttgaggcggacgcg
catgttcgcctttcctctgcgaattcgatcaatgtggggcgtctcgtaccgcaggtcgtc
tattatttctccgcttacgcacagctgcttgaacagcaggtgatcaatgtgggcgaccag
gtggacttcgtggtgcccaccggtaatttcggcaatgtgcttgccggatattacgccaaa
ctgctgggcctgccggtacgtcaactcgtcgtcgcctccgaccgcaacaatgtgctcttc
gacttcctcaccaccggcacctacaacagcaagcggccgttcttcgagaccacgtcgccg
tccatggacattctcgtctcctcgaatctggagcgcatgctctactacatgagcgagagg
gatccgcgtatgatcacctatctcatgaacgatctcgccgaatggggaacctacgaggtg
cctccggagatgctcatggagattcgcaaggtgttcgccaccggttgggccgatgaggat
caggtgcgcgagatgatcgccgactgctgggatcgcaaccactatgtgatcgacccgcat
accgcatgcggttatttcgtgatgcagcagatgccagcggatccgcaggtgcctcgtgtg
ctgctgtccactgccagcccgtacaagttcccgcgcgtggtcaatgaggcgcttgggctg
aaggcggatggcaccgatttcgaatgcatggacgaattgcacgccaaatcaggcacgccg
attccgcagatgctgcggaatctggagaatgccgaggtgcggttccgcgactgcgtcgag
gtgagcgacatgggccactacgtcgaggaatgcgccgaccggctatag

DBGET integrated database retrieval system