KEGG   Bifidobacterium animalis subsp. lactis BLC1: BLC1_0718Help
Entry
BLC1_0718         CDS       T01841                                 

Definition
(GenBank) phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bbc  Bifidobacterium animalis subsp. lactis BLC1
Pathway
bbc00010  Glycolysis / Gluconeogenesis
bbc00260  Glycine, serine and threonine metabolism
bbc00680  Methane metabolism
bbc01100  Metabolic pathways
bbc01110  Biosynthesis of secondary metabolites
bbc01120  Microbial metabolism in diverse environments
bbc01130  Biosynthesis of antibiotics
bbc01200  Carbon metabolism
bbc01230  Biosynthesis of amino acids
Module
bbc_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:bbc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BLC1_0718
  Energy metabolism
   00680 Methane metabolism
    BLC1_0718
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BLC1_0718
Enzymes [BR:bbc01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BLC1_0718
Membrane trafficking [BR:bbc04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    BLC1_0718
Exosome [BR:bbc04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BLC1_0718
  Exosomal proteins of melanoma cells
   BLC1_0718
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AEN76496
Position
882092..882916
Genome map
AA seq 274 aa AA seqDB search
MIDEVMFMRHGRTAFNLQRRLQGQIDIPLDIVGQWQVDMSGFTLAQRFYWAKVSNIARHP
DRLSQPSDPPIRRSDITEYEQAPASRRRMVVVSSDLFRAQQTAHAFADPLGLDVTLDSRL
RERDFGQWEGMSREEINERYPEGYASWKAHEGGEAAYGVESRPDLGKRGSSTIRSYCDDP
QYMDEPTTLFVVSHGSWIAATIGNLMGLPDSQLDNLTGMRNAFWSRMEPQYTSNSVLFHL
TEYDKGPDVADAVDWENGPAYLRNPDMPMWKPLI
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgatcgatgaagtgatgttcatgcgccacgggcgcaccgcattcaatttgcaacggcgc
ttgcaggggcagatcgacattccactcgatatcgtggggcagtggcaggtggatatgagc
ggattcacactcgcccaacggttctattgggccaaggtgtcgaatatcgcccggcatccg
gacaggctttcccagccctccgatcccccgattcgtcgcagcgacatcacggaatatgag
caagcccctgcgtcgcgacgccgcatggtggtcgtgagctcggatctcttccgggcccaa
cagacggcccatgctttcgccgacccgctgggattggacgtgacactcgattcgcgtctg
cgcgaacgtgatttcggccaatgggaagggatgagccgagaggagattaatgagcggtac
ccggaaggatatgcgtcgtggaaggcccatgagggcggcgaggcggcctatggggtggaa
agccgtcccgaccttggcaaacgtggcagttccacgatccgttcctattgcgacgacccc
cagtacatggatgagcccaccacgttgttcgtcgtctcccacggttcatggatcgccgca
accattggaaacctcatgggtctgccagattcgcagcttgacaatctgaccggtatgcgc
aatgcgttctggagtcgtatggaaccccagtacacttcgaattccgtgctgttccatctt
acggaatatgacaaggggccggatgtggcggacgccgttgactgggagaacggcccggcg
tacctgcgcaatccagacatgccgatgtggaaaccgctgatttag

DBGET integrated database retrieval system