KEGG   Bifidobacterium animalis subsp. lactis BLC1: BLC1_0718Help
Entry
BLC1_0718         CDS       T01841                                 

Definition
phosphoglycerate mutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bbc  Bifidobacterium animalis subsp. lactis BLC1
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:bbc01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:bbc01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bbc00010]
Metabolism; Energy metabolism; Methane metabolism [PATH:bbc00680]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:bbc00260]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
882092..882916
Genome map
AA seq 274 aa AA seqDB search
MIDEVMFMRHGRTAFNLQRRLQGQIDIPLDIVGQWQVDMSGFTLAQRFYWAKVSNIARHP
DRLSQPSDPPIRRSDITEYEQAPASRRRMVVVSSDLFRAQQTAHAFADPLGLDVTLDSRL
RERDFGQWEGMSREEINERYPEGYASWKAHEGGEAAYGVESRPDLGKRGSSTIRSYCDDP
QYMDEPTTLFVVSHGSWIAATIGNLMGLPDSQLDNLTGMRNAFWSRMEPQYTSNSVLFHL
TEYDKGPDVADAVDWENGPAYLRNPDMPMWKPLI
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgatcgatgaagtgatgttcatgcgccacgggcgcaccgcattcaatttgcaacggcgc
ttgcaggggcagatcgacattccactcgatatcgtggggcagtggcaggtggatatgagc
ggattcacactcgcccaacggttctattgggccaaggtgtcgaatatcgcccggcatccg
gacaggctttcccagccctccgatcccccgattcgtcgcagcgacatcacggaatatgag
caagcccctgcgtcgcgacgccgcatggtggtcgtgagctcggatctcttccgggcccaa
cagacggcccatgctttcgccgacccgctgggattggacgtgacactcgattcgcgtctg
cgcgaacgtgatttcggccaatgggaagggatgagccgagaggagattaatgagcggtac
ccggaaggatatgcgtcgtggaaggcccatgagggcggcgaggcggcctatggggtggaa
agccgtcccgaccttggcaaacgtggcagttccacgatccgttcctattgcgacgacccc
cagtacatggatgagcccaccacgttgttcgtcgtctcccacggttcatggatcgccgca
accattggaaacctcatgggtctgccagattcgcagcttgacaatctgaccggtatgcgc
aatgcgttctggagtcgtatggaaccccagtacacttcgaattccgtgctgttccatctt
acggaatatgacaaggggccggatgtggcggacgccgttgactgggagaacggcccggcg
tacctgcgcaatccagacatgccgatgtggaaaccgctgatttag

DBGET integrated database retrieval system