KEGG   Bifidobacterium animalis subsp. lactis BLC1: BLC1_0753Help
Entry
BLC1_0753         CDS       T01841                                 

Definition
bifunctional indole-3-glycerol phosphate synthase/tryptophan synthase subunit beta
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
bbc  Bifidobacterium animalis subsp. lactis BLC1
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bbc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BLC1_0753
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BLC1_0753
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BLC1_0753
Enzymes [BR:bbc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BLC1_0753
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
917347..919431
Genome map
AA seq 694 aa AA seqDB search
MSVLDELVAGALEDKCDRERVTSLEELKARAASAPAPLDAKRWLRRHDGIPVIAEIKRAS
PSKGHLIDIEDPAALGRQYEQGGASAISVLTEGRRFLGSLDDVDAVRAAVHIPVLRKDFI
TTDYQIWEARAHGADIVLLIVAALDDTQLAHLLKLTHELGMTALVETHTREEIERAIAAG
ARVIGINARNLKDLRVDVGKYTELASNLPEDVIKVAESGVFGAVEVEDYARAGADAVLVG
EGVATADDPRLAVERLVKAGERVKASETTPLSEHHGPYWGQFGGRYVPEALITALDELQR
VYDDAKDDPEFHKELATLNKRYVGRPSPLTEAPRFAERIKERTGLDARVFLKREDLNHTG
AHKINNAIGQALLVKRMGKTRVIAETGAGQHGVATATVCAMLGLKCRIYMGQIDARRQAL
NVARMRMLGAEVVEVTLGDRILKDAINEALRDWVTNVKDTHYLLGTVAGPHPFPEMVRDF
QKIIGEEAKEQLAQWYGIDHPDAICACVGGGSNAIGIMNAFLDDPRVNLYGFEAGGHGPD
SGQHAIRFAPGTGELGMFQGAKSYLLGNSEGQTLDTYSISAGLDYASVGPEHAWLKEIGR
VNYSWATDEEAMNAFKDLCETEGIIPAIESSHAVAGAYKAARDLKEKGYEHPVMIVNISG
RGDKDMNTAGKWFGYLTDEQAAALEANGATGNNA
NT seq 2085 nt NT seq  +upstreamnt  +downstreamnt
atgtcggttttggatgaactggtagcgggggcactcgaagacaagtgcgaccgtgaacgc
gtaacgtcgttggaagagctcaaggcccgggctgcctcggctccggctcccctcgacgcg
aaacgatggcttaggcgtcacgacggcattccggtgattgccgaaataaagcgtgcctcg
ccgtcgaaagggcatctcatcgatatagaagaccctgccgctttgggccgacaatacgaa
caaggcggtgcgagcgcaatctcggtgctcactgaaggccgcaggttcctcgggtctctt
gacgatgtcgatgccgtacgtgccgctgtgcacatcccggtgcttcggaaggatttcatc
accacggattaccagatctgggaggcgcgtgcgcatggggcggacatcgtgctgctcatc
gtcgcggcgcttgacgacacccagctggcgcatctgctgaagctcacgcatgaactcggt
atgaccgccttggtcgaaacgcatacccgtgaggaaatcgagcgggccatcgcggccggc
gcgcgtgtgatcggcatcaatgcgcgcaatctgaaggatttgcgcgtcgatgtgggcaaa
tacaccgagttggcgagcaatctgcccgaagatgtgatcaaggtggccgagtccggtgta
ttcggtgccgttgaagttgaggattatgcccgcgccggagccgacgctgttctggtggga
gagggcgtggccaccgccgatgacccgcggctggccgtggaacgattagtgaaggcagga
gaacgagtgaaagcttctgaaaccactccgttgagcgaacatcatggcccgtattggggg
cagttcggcggtcgctatgtgccggaggcgcttatcaccgccctcgatgaattgcagcgt
gtgtacgacgacgcgaaagatgatcccgaattccacaaggagctcgccacgctcaataag
cgctatgtgggacgtccttcaccgctcaccgaggcgccgcgattcgccgaacgcatcaag
gaacgcaccggactcgacgccagagtgttcctcaagcgtgaggacctcaaccataccggt
gcccataagatcaataatgcgatcgggcaggcactgctcgtcaagcgcatgggcaagacc
cgcgtgatcgcggagaccggagcaggacagcacggcgttgccacggccaccgtgtgtgcg
atgctcggtctcaagtgccgcatctacatgggacagatcgacgcacggcgacaggcgctc
aacgtggcccgcatgcgcatgctgggcgccgaggtggtcgaagtgacacttggtgaccgt
attctcaaggacgccatcaacgaggcgctgcgtgattgggtcaccaacgtcaaagacacc
cactatctgcttggtaccgtcgcaggtccccatccgttcccggagatggtgcgtgacttt
cagaagatcataggtgaggaggcgaaggagcagctggcacagtggtacggcatcgatcat
cccgatgcgatctgcgcctgcgtgggcggcggttccaatgccatcggcatcatgaacgcc
ttcctcgacgatccgcgcgtcaacctctatggtttcgaggctggcggccacggtccggac
tccggccagcatgccatccgtttcgcaccgggaaccggtgaactcggcatgttccagggg
gccaaaagctatctgcttgggaactctgagggacagacccttgacacctactcgatttcc
gcaggccttgattatgcgtccgttggcccagaacacgcatggctcaaggaaatcggacgt
gtgaactattcatgggcgaccgatgaggaagcgatgaacgcgttcaaggatctgtgcgag
accgagggcatcattccagccatcgagagctcccatgccgtcgccggcgcctataaagcg
gcacgggatctcaaggagaagggctatgagcatccggtgatgattgtgaacatctcggga
cgcggcgacaaggacatgaacaccgccggcaagtggttcggatatctcaccgatgagcag
gcagccgcactcgaggcgaacggtgcgaccggcaacaacgcgtga

DBGET integrated database retrieval system