KEGG   Bifidobacterium animalis subsp. lactis BLC1: BLC1_0754Help
Entry
BLC1_0754         CDS       T01841                                 

Definition
tryptophan synthase subunit alpha
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
bbc  Bifidobacterium animalis subsp. lactis BLC1
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bbc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BLC1_0754
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BLC1_0754
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BLC1_0754
Enzymes [BR:bbc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BLC1_0754
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
919457..920326
Genome map
AA seq 289 aa AA seqDB search
MTEYNTTPSGQPLGISHRPSPCRELFTRFKAQDKPAFIGYLPFGFPTMEQSLEAFATMVE
NGADIVEIGLPYSDPVMDGPVIQAASQIALNNGERIADVFKAVETVANAGGVPLIMSYWN
LIYHYGVERFAADFANAGGAGLITPDLIPDEAGEWIEASDRHGLDRIFLVSPDSTDERLR
VVCENARGFVYAASRMGVTGERSSLGTSPEDLVARTRKAGAENVCVGIGVSTAAQGKAVG
QYADGVIVGSALVHTLLTEDGDARELTSGLAALAAKTAELAEGIHNARL
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaatacaacaccacgccaagcggtcagccgcttggaatcagccatcgtcccagc
ccatgccgcgagctgttcacacggttcaaagcgcaggacaagcctgcattcattgggtac
ctgccattcggattccccacgatggaacagtcactcgaggccttcgccacgatggtcgag
aacggtgctgacattgtcgagataggactgccgtattccgatccggtgatggatggcccg
gtgatccaggccgccagccagatcgccctgaacaatggcgagcgcatagccgatgtgttc
aaggccgtggagacggtggccaatgccggtggagtgccgctcatcatgagctactggaac
ctcatctaccattatggggttgaacgcttcgccgctgatttcgcgaatgcaggaggcgca
ggccttatcactcccgatctcattcccgacgaggcaggggagtggatcgaggcgtcggac
cgccatgggctcgatcgcatcttccttgtttcccccgactccaccgatgagcgtctgcgg
gtggtgtgtgaaaacgcccggggattcgtctatgcggcatcgcgcatgggcgtgactggc
gaacggtcgagtctagggacttccccggaggatcttgtggcccggacccgtaaggccggg
gccgagaatgtgtgtgtgggcatcggcgtctccaccgctgctcaaggcaaggccgtcggg
cagtatgcagacggggtcatcgttggatccgccttggtccacaccctgctcaccgaggat
ggcgatgcgcgcgagctcacctcaggtctggctgcgttggcggccaagaccgcagaactc
gccgagggcatccacaacgcacgcctgtag

DBGET integrated database retrieval system