KEGG   Bifidobacterium animalis subsp. lactis BLC1: BLC1_0809Help
Entry
BLC1_0809         CDS       T01841                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bbc  Bifidobacterium animalis subsp. lactis BLC1
Pathway
bbc00010  Glycolysis / Gluconeogenesis
bbc00051  Fructose and mannose metabolism
bbc00562  Inositol phosphate metabolism
bbc01100  Metabolic pathways
bbc01110  Biosynthesis of secondary metabolites
bbc01120  Microbial metabolism in diverse environments
bbc01130  Biosynthesis of antibiotics
bbc01200  Carbon metabolism
bbc01230  Biosynthesis of amino acids
Module
bbc_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:bbc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BLC1_0809
   00051 Fructose and mannose metabolism
    BLC1_0809
   00562 Inositol phosphate metabolism
    BLC1_0809
Enzymes [BR:bbc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     BLC1_0809
Exosome [BR:bbc04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   BLC1_0809
  Exosomal proteins of bladder cancer cells
   BLC1_0809
  Exosomal proteins of melanoma cells
   BLC1_0809
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AEN76587
Position
complement(974181..974993)
Genome map
AA seq 270 aa AA seqDB search
MASTRRIPMVAGNWKMNFDHLEATEFVRAFSKNLKRCHFDFNRCEVALFPSFTSIRSVQV
MVESEHLRIRYGAQAVSVTSQGAFTGDVSADMLAHLGCSYVIVGHSERRKYHPEDDANIV
DQVRAVLAAGMQPILCVGESLEERRKGIELEFAVGQVHDVTRDLSDGEASKLIIAYEPVW
AIGTGMVATPQTAQDAAHAFRVDLAKSFGDHVAQTVRVLYGGSVSSKNCVELIEEPDVDG
FLIGGAALDVDELTTICRKTIATTSSHDNS
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atggcatcgacacgacgcatccccatggttgcgggcaattggaagatgaacttcgatcat
cttgaggcgaccgagttcgtccgggcattctccaagaacctcaaacgatgccattttgac
ttcaatcgttgcgaagtggcgctcttcccgtcattcacctcgattcgtagcgttcaggtg
atggtggaatccgaacacttgcgcatcagatacggggcccaggccgtttcggtcacgtca
cagggggcgttcaccggtgacgtctctgcggacatgctcgcgcatctgggttgcagctat
gtgattgtaggccattcggaacggcgcaaataccatccggaggacgatgcgaacatcgtc
gatcaggtacgagcggtgcttgccgccggcatgcagccaatcctatgcgtcggcgagagt
ctggaggagaggcgaaagggcattgaacttgagtttgccgtcggacaggtgcatgacgtg
acacgcgacctttccgatggggaggcatcaaaactcatcatcgcctatgaacccgtctgg
gcgattggcacgggcatggttgctacaccgcagacagcgcaggacgccgcccatgccttc
cgcgtggatctggcgaaatcattcggcgaccatgtggcgcagaccgtgcgtgtactgtat
ggaggctcggtgtcttcgaagaactgtgtggagctgattgaggagccggacgtcgacggc
ttcctcatcggaggtgccgccctcgacgtcgatgagctcaccacaatctgcaggaagacg
attgcgacaacatcttcacatgataatagttga

DBGET integrated database retrieval system