KEGG   Bifidobacterium animalis subsp. lactis BLC1: BLC1_0840Help
Entry
BLC1_0840         CDS       T01841                                 

Definition
aspartate carbamoyltransferase, catalytic subunit
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
bbc  Bifidobacterium animalis subsp. lactis BLC1
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Module
Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Brite
KEGG Orthology (KO) [BR:bbc00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    BLC1_0840
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BLC1_0840
Enzymes [BR:bbc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     BLC1_0840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1008575..1009588)
Genome map
AA seq 337 aa AA seqDB search
MKGEPLSSVQQHADGQSIVGTSVITLDDLTVTQIEELLHKAQYIDSHRKEVAHTCDGRVL
ATLFYEPSTRTRLSFETAMLRLGGKVIGFAGSQLSSATKGESISDTLKTVSNYVDVVAIR
HPKEGAALVAADASSVPVINAGDGGHMHPTQTLADLATLQSRFGRVNGLTIGLCGDLTFG
RTVHSLIETLCRFGNVRFVLISPKELRTPQYVLNRINATPTCSYEEVTDLSTVIGDLDAL
YMTRVQKERFFNEDDYLRLRDTYILDEGKLAKAKPTMAVLHPLPRVNEIATEVDVDPRAA
YFEQVKNGMLMRMALESSVLGDELPGYEQYANQEVEA
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggtgagccattgtctagcgttcagcaacacgccgacggacagtccatagtggga
accagcgtcatcaccctcgacgatctcacagtcacgcaaatcgaggagttgctgcataaa
gcgcagtacatcgattcgcatcgcaaggaagtggcacacacctgtgacggacgggtgttg
gccactttgttttatgagccaagcacgcgcacgcgactgagcttcgagaccgcaatgctg
cggttgggcggcaaggtgatcggttttgcgggatcgcagctgagctccgcaacgaagggc
gaatcgatttcggacacgttgaagaccgtgtcgaactacgtcgacgtcgtggcgatccgt
cacccgaaggaaggcgccgccctggtggccgcggacgcctcctcggtgccggtgatcaac
gccggcgacggcggccacatgcacccgacgcagacgctcgccgatctcgcgacactgcag
tcgcgattcggacgggtgaacggcctgacgatcggcctgtgcggcgacctgaccttcggc
cgcaccgtgcactcgctcatcgagacgctgtgccgcttcggcaacgtgcgtttcgtgctc
atctcaccgaaggagctgcgcaccccgcaatacgtgctcaaccgcatcaacgccacgccc
acctgctcgtacgaggaggtcaccgacttgagtacggtcataggggatctggacgccctg
tacatgacgcgcgtgcagaaggaacgcttcttcaacgaagacgattacctgcgcctgcgt
gacacctacattcttgacgagggcaaactcgcgaaggccaaacccacgatggcggtgctg
cacccgttgccgcgcgtcaacgaaatcgccacggaggtggacgtcgacccccgtgccgcc
tatttcgaacaggtgaagaacggcatgctcatgcgcatggcattggaaagctcggtgctc
ggcgacgaattgcccggctacgagcagtatgcgaaccaggaggtcgaagcctga

DBGET integrated database retrieval system