KEGG   Bifidobacterium animalis subsp. lactis BLC1: BLC1_1128Help
Entry
BLC1_1128         CDS       T01841                                 

Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
bbc  Bifidobacterium animalis subsp. lactis BLC1
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:bbc00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    BLC1_1128
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BLC1_1128
Enzymes [BR:bbc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     BLC1_1128
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1349529..1351079
Genome map
AA seq 516 aa AA seqDB search
MSLSLQSAARELFAENLLHEIITPHMWTMNAASVENNEVPFTAITYDTRTVTPGSLLVCK
GNFNPKYLEQANKLGMAAYVATNDYSAYTDAPGLIVSDDKKALSILAQAYYDHPERQLTL
IGITGTKGKTTTAYYTHAIINALSGNTTALFSSVDNCVDGMHYVESDLTTPESLDAVRMM
REAVNNGMKYLVMEVSSQAYKVNRVYDFHFDVAAFLNISPDHISPIEHPSFENYLWCKRQ
IIRNADMLVLGERSDHEQLLLEDAELNRVPVSTFALADSPAQSDIADVTCAPTNMEHTAF
DYFVDGERLGSLTLAMEGDFNYANAAAALAIAHDIGMDVSDPRALASLADVRISGRMEEM
HDSRSNTLAIVDYAHNFASVNALLDFVEQRYGAEHPHITLITGSAGNKAYDRREGIVKAA
QDRVQKLILTAEDTDTEPIEQICSEMANNVTNEDLDVQTILDRAEAVKHAVDEARAADGG
LSILLLIGKGDEQWIKDRNIHTPYEGDSQIIRRLFA
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgtctttgtcgttgcaatccgcagcacgcgagctcttcgcggagaatctgctgcatgag
atcatcaccccgcacatgtggaccatgaacgcggcctccgtagagaacaacgaggtgccg
ttcacggcaatcacctacgacacgcgcacggtgacgccaggcagtctgctcgtatgcaaa
gggaacttcaatccgaaatacctcgagcaggcgaacaagctcggcatggcggcgtacgtg
gcgacgaacgattattcggcgtacacggacgcgcccgggctcatcgtctccgacgacaag
aaagcactcagcattctcgcccaggcatactacgaccacccggagcgtcagctcacactg
atcggcatcaccggcaccaagggcaagaccaccaccgcgtactacacgcacgccatcatc
aacgcgctgagtggaaacacgacggcattgttctcgtcggtggacaattgcgtggacggc
atgcactacgtggaatccgacctcacgacgcccgaatcgctcgacgcggtgcgcatgatg
cgcgaggcggtgaacaacggcatgaaatacctggtgatggaggtctcctcacaggcatac
aaagtcaaccgcgtctacgatttccatttcgacgtcgccgcgttcctcaacatctccccc
gatcacatcagccccatcgagcaccccagtttcgagaactacctgtggtgcaagcggcag
atcatacgcaatgccgacatgctcgtgctcggcgagcgcagcgaccacgagcaactgctg
ctcgaggatgccgaactgaaccgcgtacccgtctccacgttcgcattggccgattcgccg
gcgcagtccgacatcgcggacgtcacctgcgcaccgaccaatatggagcacacggcattc
gactacttcgtggacggcgagcgtctcggcagcctcacgctcgcaatggagggcgacttc
aactatgcgaacgcggccgccgctctggcaatcgcgcatgacatcggcatggatgtgagc
gacccgcgtgcgctcgcctcactcgccgacgtacgcatctcgggacgcatggaggagatg
cacgacagcaggtcgaacacgctcgccattgtcgactacgcgcacaatttcgcctcggtg
aacgcgttgctcgatttcgtggagcagcggtacggcgccgagcatccgcatatcacgctg
atcaccggttcggccggcaacaaggcatacgaccgtcgcgagggaatcgtcaaagccgca
caggaccgcgtgcagaagctcattctcactgcggaggacaccgacaccgagcccatcgag
caaatctgcagcgagatggccaacaacgtgacgaacgaggatctcgatgtgcagacgatc
ctcgaccgtgccgaagccgtgaagcatgccgtcgacgaggcgcgtgcggcggacggcgga
ctgagcatcctgctgctcataggcaagggcgacgagcagtggatcaaggaccgcaacatc
cacacgccatacgagggcgactcgcagatcatccgacgtctgttcgcttga

  All links  
No link information was found.   
DBGET integrated database retrieval system