KEGG   Bifidobacterium animalis subsp. lactis BLC1: BLC1_1451Help
Entry
BLC1_1451         CDS       T01841                                 

Definition
PfkB family sugar kinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
bbc  Bifidobacterium animalis subsp. lactis BLC1
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:bbc00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BLC1_1451
Enzymes [BR:bbc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     BLC1_1451
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1760703..1761671)
Genome map
AA seq 322 aa AA seqDB search
MNQILDKLEQIHGSVSVVGSMNADYTVTTERLPGPGETVTGGPLQVLPGGKSGNQAAAAA
KLGATVRMFGAVGSDSNADFLLTQLASAGVNTDGIRKVLGPSGTTVITVDSHGENTIVYS
PGSNANVTVEYIESQRDLLTASSVLGLCLESPLETVTACATMCHDAGMKVLLNDSPFIAT
LPSELIAHADILLVNEHELVQLLHIDEPEDDDWDSFDWAQAQNRLSEFGFDQAIVTLGGD
GSVVLDSTVDPSIIRIAPVRVDAVDTTGCGDSFMGTVLASLASGLSLEESAQLASYVSAY
AATGYGAQASYGTAAQIRERFR
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgaatcagattctcgataagctggagcagattcacggatccgtctccgtggtcggttcg
atgaacgcagattacacggtgaccaccgagcggctccccgggccgggggagaccgtgacc
ggcggcccgctacaggtgctgcccggtggcaaatcgggcaatcaggccgccgctgccgcc
aagctcggcgccaccgtgcgcatgttcggtgcagtgggctccgactcgaatgcggatttc
ctgctgactcagctcgcatccgccggagtgaacaccgatggcattcgcaaggtgctcggc
cccagcggcacgacggtgatcactgtggattcccatggcgagaacaccattgtgtattcg
ccgggttccaacgcgaacgtgacggtggaatacatcgaatcccagcgcgatctgcttacc
gcatcgtcggtgctgggactgtgtttggaaagcccgcttgaaacagtgaccgcatgcgcg
accatgtgccatgatgcgggtatgaaggtgctgctcaacgattcgcccttcattgcgacg
ttgccgtccgaactcattgcgcatgccgacattctgctggtcaatgagcatgagctcgtg
cagctgctgcacattgacgagcctgaagatgatgactgggattcgttcgattgggcacag
gctcagaaccgtttgagcgagttcggttttgatcaggcgattgtgacgcttggcggcgac
ggttcggtggtgcttgactccacggtggatccatcgatcatccgcattgccccggtgcgt
gtggatgcggtggataccacgggctgcggcgattcgttcatgggcactgtgctggcttca
ttggccagtggactgagcttggaggagtccgcgcaactggcttcgtatgtgtcggcatat
gcggccaccggctatggtgcgcaggcctcctatggcaccgccgcgcagattcgggagcgc
ttccgctaa

DBGET integrated database retrieval system