KEGG   Belliella baltica: Belba_0081Help
Entry
Belba_0081        CDS       T02134                                 

Definition
L-glutaminase (EC:3.5.1.2)
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
bbd  Belliella baltica
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bbd00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Belba_0081
   00330 Arginine and proline metabolism
    Belba_0081
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    Belba_0081
Enzymes [BR:bbd01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     Belba_0081
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(77713..78627)
Genome map
AA seq 304 aa AA seqDB search
MDYQQIIEEVYQEVQEENQRGKVATYIPELASVNPDQFGIALVDLKGNVFGVGDYQVPFS
IQSISKVHTLTMVFHVFNSKLFTRVNVEPSGNPFNSIAQLEFEKGIPRNPFINAGALVIT
DALCSKFQKPIEQISDFINEISGKNCVSFNESVKKSEQNHGERNTALAYFLKSYKNFNNN
IDEVLDVYFSQCAIEMNCVDLAKSFSYLANDGFSIFANREILSESHARRVNALMLTCGFY
DEAGEFAFRVGLPGKSGVGGGVAAVMPHKFSIAVWSPELNEKGNSVKAIKALELLTDKLS
FSLF
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atggattatcagcaaatcatagaagaagtatatcaggaagtgcaggaagaaaatcagcgg
gggaaagtggccacttatatcccagaattagccagtgtcaatcccgatcaatttgggatt
gctttggttgatttgaaagggaatgtgtttggagttggggattatcaggtgcctttttcc
atccaaagtatcagcaaggtccatacactgacaatggtctttcatgtcttcaattccaaa
cttttcactagagtaaatgtcgagccaagtggtaatccatttaattcgattgcgcagctg
gaatttgaaaaaggaattcctaggaatccttttatcaatgctggggctttggtgattaca
gacgcactttgcagcaagtttcaaaaaccaatagagcagatttctgattttatcaatgaa
atatcagggaaaaattgtgtgagtttcaatgagagtgtcaaaaaatcagagcaaaatcat
ggggagcgaaatactgctttggcctattttctaaagtcctacaagaattttaacaacaat
attgatgaggtgttggatgtctatttttcccaatgtgccattgaaatgaattgtgtagac
ttggcaaaatctttctcttatttggcaaatgatggtttttctatctttgctaatagggaa
atcttatcggaaagtcatgcaagaagggtgaacgcactgatgttaacttgtggattttat
gatgaagcaggagaatttgcatttcgagtaggcctacccggaaaaagtggagtaggtggt
ggtgtagctgcagtgatgcctcacaaatttagtatcgctgtctggagtcccgaactcaat
gaaaaagggaactcagtaaaagctatcaaagcattggagcttttgactgataaattgtct
ttttctcttttttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system