KEGG   Belliella baltica: Belba_0196Help
Entry
Belba_0196        CDS       T02134                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
bbd  Belliella baltica
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bbd00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Belba_0196
Enzymes [BR:bbd01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Belba_0196
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(204831..205526)
Genome map
AA seq 231 aa AA seqDB search
MKQKETLLNTMGINISRDIDEIGDEHVGTSFETPLREDAFEMDDELKIELIEKHFREIMH
VLGLDLTDDSLKGTPRRVAKMYIQEIFSGLDPKNKPDAKLFENKYKYNEMLVEKDITFFS
NCEHHFVPIYGKAHVAYISNGTVIGLSKINRIVQYFAKRPQVQERLTMQIGNELKEILGT
DDVAVVIDAHHMCVSSRGIKDVNSSTVTSFYSGKFEKEEHTRNEFMKYISL
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgaaacagaaagaaactttgttgaatacgatgggaattaatatcagcagggatattgat
gagattggtgatgaacatgtaggcacatcctttgaaactccccttcgtgaagatgccttt
gaaatggatgatgagcttaaaattgagttgatcgaaaagcacttcagagaaatcatgcat
gttttaggactcgacctgacagatgacagcttgaaaggaactcctaggagagttgctaaa
atgtatatccaagagatttttagtggacttgacccgaaaaacaagcctgacgctaaatta
tttgagaataaatacaaatacaatgagatgttggtggagaaggatatcactttcttttcc
aactgcgaacatcatttcgtgcctatctatgggaaagcgcatgtcgcttatatttctaat
ggtacagtaatcggactttctaaaatcaatagaatagttcagtattttgccaaaagacct
caggttcaagaaagattgactatgcagattggtaatgaattgaaagaaattttgggcaca
gatgatgtggcagttgtcatcgatgcacatcacatgtgtgtttcttcaagaggtataaaa
gacgtgaatagttccacagttacttctttctacagcggtaaatttgaaaaagaagagcat
actagaaatgaatttatgaaatacatttctttataa

DBGET integrated database retrieval system