KEGG   Belliella baltica: Belba_0225Help
Entry
Belba_0225        CDS       T02134                                 

Definition
delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
bbd  Belliella baltica
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bbd00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Belba_0225
Enzymes [BR:bbd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Belba_0225
Exosome [BR:bbd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Belba_0225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
234004..235005
Genome map
AA seq 333 aa AA seqDB search
MLTLQETSSVMQRRPRRNRKSQAIRNMVEETRLSVKDFIFPMFLIDGVNQKVEVASMPGI
YRYSLDLMLKEIEDCVNLGIMAFDIFPAYPESKKDKYATESHNPETFYLKAIHKIKTTFP
EIVVMTDVAMDPYSSDGHDGLVENGKILNDETLEILGKMSLAQAHAGADILGPSDMMDGR
VGFIRNVLDENGYTDVSIMSYTAKYASAFYGPFRDALDSAPKSGDKKTYQMDSANYYEAM
IEADLDTEEGADFLMVKPALAYLDVIRLLKDNSNLPIAAYNVSGEYAMIKASAERGWLDG
ERAMLESLLSIKRAGANVILSYFAKEYALIARD
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgttaactttgcaggaaacaagttcagttatgcaaagaagaccaagaaggaatagaaag
tctcaagccatcagaaacatggtggaagaaacgaggctttctgtaaaagactttattttc
ccgatgtttttgatcgatggtgtcaatcaaaaggtagaagtagcttccatgccaggcatc
tacagatactccttggatctcatgctgaaagagatcgaagactgtgtcaatttggggatc
atggcttttgatattttccctgcataccctgaaagcaaaaaagacaagtacgctacagaa
agccacaaccctgagaccttttacctcaaagccatccataaaatcaagactacttttccc
gagatcgtggtgatgactgatgtggctatggatccttatagttcagatggccatgatggc
ttggtggaaaatggcaaaattcttaatgatgaaactttggagatcttgggaaagatgtcg
cttgcacaggctcatgccggagcagatattctaggcccttctgatatgatggatggaaga
gttggctttatcagaaatgtcttggatgaaaatggctacacagatgtatcaataatgtcc
tacaccgccaaatatgcatctgctttttatggtccatttagagatgctcttgattctgct
ccaaagtccggagataaaaaaacttaccaaatggattctgccaactattatgaagcgatg
attgaggcagatttggatacagaagaaggagctgatttcttaatggtcaaacctgcacta
gcatatttagatgtgatccgactattgaaagacaattccaatttacccatcgcagcgtac
aatgtcagcggagaatatgccatgatcaaagcctctgcagaaagaggatggctagacgga
gaaagagccatgctagagtccctcctcagcatcaaacgcgctggagcgaatgtgatttta
agttattttgcaaaggagtatgccttgatagcgagagattga

DBGET integrated database retrieval system