KEGG   Belliella baltica: Belba_0670Help
Entry
Belba_0670        CDS       T02134                                 

Definition
(GenBank) uroporphyrinogen-III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
bbd  Belliella baltica
Pathway
bbd00860  Porphyrin and chlorophyll metabolism
bbd01100  Metabolic pathways
bbd01110  Biosynthesis of secondary metabolites
bbd01120  Microbial metabolism in diverse environments
Module
bbd_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:bbd00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Belba_0670
Enzymes [BR:bbd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Belba_0670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 Peripla_BP_3
Motif
Other DBs
NCBI-ProteinID: AFL83325
UniProt: I3Z257
Position
complement(710878..711651)
Genome map
AA seq 257 aa AA seqDB search
MSKSTKDRFNPVKSILVSQPKPSGDDSPYFQLAEKYNLKIDFRPFIQVEPVSLKDFRKQK
IEILKHTAIIFTSRNAIDHFFTICKELKIEMPADMKYFCISDQTAHYLQKYIVIRKRKLF
VGQKTASDLFDYFKKHKSEKYLFPCSDIRKDEIPNYMAKNNIEFTEAIIYHTVAADLSDL
RDIKYDVLAFFSPSGIKSLITNFPDFKQNNTRIAAFGPTTAEAVREENLILDIEAPMPNA
PSMTGALELYIKKANNL
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaatctaccaaagacagattcaacccagtaaaaagcatattagtttcacagcca
aagccgagtggtgatgattctccttatttccaacttgctgagaaatataacctcaagatt
gattttaggccatttatccaagtcgagccagtttcactgaaagacttcagaaagcagaag
atcgaaatcttgaaacatacagctattatttttacgagtagaaatgccatagatcatttt
tttacaatctgtaaagaattaaaaatagaaatgcctgcggatatgaaatacttctgtatt
tcagaccaaacagcgcattaccttcaaaaatatatagtaatcagaaaaagaaagttattt
gttggacaaaaaacagcatctgatttattcgattattttaaaaaacacaagtcagagaaa
tatttattcccatgttcggatatcagaaaagatgaaatccccaactacatggccaaaaat
aatatcgagtttacagaagcgatcatctatcatactgtagcggctgatttgtcagactta
agggatatcaagtatgatgtattggctttttttagcccttcaggtatcaaatcattgatt
acaaatttccctgacttcaaacaaaataacacaagaattgctgcatttggtcccaccaca
gcagaagcagttagagaagaaaatttgattttggacattgaagcaccaatgccaaatgca
ccaagtatgactggcgcattggagctttacataaaaaaagcaaataatttataa

DBGET integrated database retrieval system