KEGG   Belliella baltica: Belba_0670Help
Entry
Belba_0670        CDS       T02134                                 

Definition
uroporphyrinogen-III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
bbd  Belliella baltica
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:bbd00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(710878..711651)
Genome map
AA seq 257 aa AA seqDB search
MSKSTKDRFNPVKSILVSQPKPSGDDSPYFQLAEKYNLKIDFRPFIQVEPVSLKDFRKQK
IEILKHTAIIFTSRNAIDHFFTICKELKIEMPADMKYFCISDQTAHYLQKYIVIRKRKLF
VGQKTASDLFDYFKKHKSEKYLFPCSDIRKDEIPNYMAKNNIEFTEAIIYHTVAADLSDL
RDIKYDVLAFFSPSGIKSLITNFPDFKQNNTRIAAFGPTTAEAVREENLILDIEAPMPNA
PSMTGALELYIKKANNL
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaatctaccaaagacagattcaacccagtaaaaagcatattagtttcacagcca
aagccgagtggtgatgattctccttatttccaacttgctgagaaatataacctcaagatt
gattttaggccatttatccaagtcgagccagtttcactgaaagacttcagaaagcagaag
atcgaaatcttgaaacatacagctattatttttacgagtagaaatgccatagatcatttt
tttacaatctgtaaagaattaaaaatagaaatgcctgcggatatgaaatacttctgtatt
tcagaccaaacagcgcattaccttcaaaaatatatagtaatcagaaaaagaaagttattt
gttggacaaaaaacagcatctgatttattcgattattttaaaaaacacaagtcagagaaa
tatttattcccatgttcggatatcagaaaagatgaaatccccaactacatggccaaaaat
aatatcgagtttacagaagcgatcatctatcatactgtagcggctgatttgtcagactta
agggatatcaagtatgatgtattggctttttttagcccttcaggtatcaaatcattgatt
acaaatttccctgacttcaaacaaaataacacaagaattgctgcatttggtcccaccaca
gcagaagcagttagagaagaaaatttgattttggacattgaagcaccaatgccaaatgca
ccaagtatgactggcgcattggagctttacataaaaaaagcaaataatttataa

DBGET integrated database retrieval system