KEGG   Belliella baltica: Belba_0907Help
Entry
Belba_0907        CDS       T02134                                 

Definition
dTDP-4-dehydrorhamnose 3,5-epimerase (EC:5.1.3.13)
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
bbd  Belliella baltica
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bbd00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Belba_0907
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Belba_0907
Enzymes [BR:bbd01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     Belba_0907
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
950980..951528
Genome map
AA seq 182 aa AA seqDB search
MKVHPTPFEGVFELIPRIFEDSRGYFFESFRAEALESQGIQINWVQENQSYSQAGTIRGL
HFQKKPYAQAKLVRVIHGKVLDVIVDLREDSKTFGQHFSIVLDSKINNALFIPEGFAHGF
SVLDTAIFMYRCSNYYNKEAEGGILWNDPELNIDWQVENPILSEKDITWPTLEEFKRHTG
GL
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtacacccaactccatttgaaggggtttttgaactgataccaaggatttttgaa
gatagtagagggtatttctttgaatcctttagagcggaagccttagaatcacaaggaata
caaatcaattgggttcaagagaatcaatcttactcccaagcgggaaccatccgtggttta
cattttcaaaaaaaaccttatgctcaagccaaattggttcgggttatccatggaaaagtt
ttagatgtaattgttgatttgagagaggattccaagacttttggtcaacattttagtata
gtgctagatagtaaaatcaacaatgccctatttattccagagggttttgctcatggattt
tctgtattggatacagcgattttcatgtacaggtgttccaattattataataaagaagct
gaaggaggaattctatggaatgatcctgagttaaatatagattggcaagtagaaaatcct
attctttctgaaaaagatattacatggccaacattagaggaatttaaaagacacacaggg
ggtttataa

DBGET integrated database retrieval system