KEGG   Belliella baltica: Belba_1070Help
Entry
Belba_1070        CDS       T02134                                 

Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bbd  Belliella baltica
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bbd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Belba_1070
   01230 Biosynthesis of amino acids
    Belba_1070
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Belba_1070
   00051 Fructose and mannose metabolism
    Belba_1070
   00562 Inositol phosphate metabolism
    Belba_1070
Enzymes [BR:bbd01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Belba_1070
Exosome [BR:bbd04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Belba_1070
  Exosomal proteins of bladder cancer cells
   Belba_1070
  Exosomal proteins of melanoma cells
   Belba_1070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1126131..1126892
Genome map
AA seq 253 aa AA seqDB search
MRKKIVAGNWKMNLNFDEGQKLTTEIVNMYKDENIKDVTVVLNPPFVHLFPVKKLVGNTP
NLFLGGQNCSDKASGAFTGETSATMLKSFGAEYVIIGHSERREYFKESNELLTAKVKQAL
ENGLTPIFCCGEPLEIREAGTHEAYVKNQLTESLFGLSAEGFAKIVIAYEPIWAIGTGKT
ASSDQAQEMHKALRDHLASKYGQNAADNTSILYGGSCNPGNAKDIFSKADVDGGLIGGAS
LKSRDFVDIIKSF
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaagaaaattgtagcaggaaactggaaaatgaatctcaattttgacgaaggtcag
aaactgacaactgagattgtcaatatgtataaagatgaaaacatcaaagatgttaccgtg
gttttgaacccgccttttgttcatctttttcctgtcaaaaaattagtcggaaatactcca
aacttatttttaggaggacaaaattgctctgataaagcttctggggcatttacaggagaa
acatcagctactatgttgaagtcttttggagccgagtatgtgatcattggccacagtgaa
agaagagaatatttcaaagaaagtaatgaactccttactgctaaagtaaaacaagcattg
gaaaatgggcttacgccaatattctgctgtggtgagcctctggaaatcagagaagctggt
acacatgaggcttatgtgaaaaaccaattaacagaaagcttattcggcttgagtgctgag
ggttttgcaaaaatcgtaattgcctatgaaccaatctgggctataggtacaggaaaaact
gcttcttcagatcaggcgcaagaaatgcacaaagctctccgagatcatttggcaagcaaa
tatggtcaaaatgcagctgataatacgtcaatcctttacggaggtagttgtaatccaggc
aatgccaaagatattttctccaaagcagatgtagatggtggtttgatcggcggagcgtca
ttgaagtcaagagattttgtagatataattaaatcattctaa

DBGET integrated database retrieval system