KEGG   Belliella baltica: Belba_1341Help
Entry
Belba_1341        CDS       T02134                                 

Definition
(RefSeq) 2-oxoglutarate dehydrogenase complex dihydrolipoamide succinyltransferase (EC:2.3.1.61)
  KO
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bbd  Belliella baltica
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bbd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Belba_1341
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Belba_1341
  Amino acid metabolism
   00310 Lysine degradation
    Belba_1341
Enzymes [BR:bbd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Belba_1341
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1427549..1429090
Genome map
AA seq 513 aa AA seqDB search
MSLEIKVPTVGESISEVTIGQWFKKDGDFVEMDEVICELESDKATFELAAEAAGILKTMA
AEGDILEIGAVICEINTDGQAGGKIEKSEKPAESSSSSAGGKTGEVKDMIVPTVGESITE
VTLANWLKADGDYVELDEIIAEVDSDKATFELPAEANGILRHVAQEGDTLEIGGLICKIE
VMEGGAPASDDSKEEVSDKSSGTSTSDKETYATGHASPAATKILAEKGISANDVKGTGKD
GRITKEDAEKAEKSAPKPAASKPAESKKEEKSEAAPKVAGSRDSRREKMTSLRKTVSRRL
VSVKNETAMLTTFNEVNMGPIMEMRKKFKDQFKEKHGVNLGFMSFFTKAVCVALQEWPAV
NAQIDGNEIVYNDFCDISIAVSAPKGLVVPVIRNAEAMSFEEIEKEVVRLATKARDNKLS
IEEMTGGTFTLTNGGIFGSMMSTPIINAPQSAILGMHNIVERPMAVNGEVKILPMMYLAL
SYDHRIIDGRESVSFLVRVKQLLEDPTRLLFGV
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgagcctagaaatcaaagtccctaccgtaggggaatctatcagtgaagtgaccattgga
cagtggttcaaaaaagacggcgacttcgtagaaatggatgaagtgatctgtgaattggaa
tccgataaagcaacttttgaattggcagcagaggctgcaggtattttgaaaaccatggca
gctgaaggagatatcttagaaatcggtgctgtgatctgtgaaatcaatactgatggtcaa
gctggaggaaaaattgaaaaatcagaaaaacctgctgaatcttcttcttcatctgcagga
ggaaaaactggcgaggtgaaagatatgatcgttccaacagtaggtgagtcgatcactgaa
gttactttggccaactggctaaaagctgatggagattatgtggaattggacgaaatcatc
gctgaagtagattctgacaaagcaacttttgaacttcctgcggaggcaaatggaattttg
agacatgttgcacaggaaggcgatacgttagaaatcggaggattgatctgtaagattgaa
gtgatggaaggtggagcaccagcatcagacgattctaaggaagaggtctctgataaatct
tcaggtacatctacatctgataaagaaacttatgccacaggtcatgcttctcccgcagct
acgaagattcttgcagaaaaaggaatcagtgccaatgacgtgaaaggaactggcaaggat
ggtagaatcacgaaagaagatgctgaaaaagctgaaaaatctgctcctaaaccagcagca
tcaaaaccagctgaatccaaaaaagaagaaaaatctgaagctgctccaaaggtagctgga
tcaagagatagtagaagagagaaaatgacttctcttcgaaaaactgtttccagaagattg
gtttctgtgaaaaacgaaacagccatgttgaccacgttcaatgaagtgaacatgggtcca
atcatggaaatgagaaagaaattcaaagatcaattcaaggagaagcatggtgtgaacctt
ggtttcatgtctttcttcaccaaagcagtatgcgtggcattgcaagaatggcctgctgtg
aatgctcaaattgatggaaacgaaatcgtttataatgatttctgtgatatttctattgct
gtttctgcgccaaaaggacttgtagttcctgtcatcagaaatgctgaggccatgagcttt
gaagaaatcgaaaaagaagtagtgagattggctaccaaagcgagagacaataaattgtct
attgaggaaatgacaggtggtacattcactttgactaatggtggaatcttcggttccatg
atgtcaactccgatcatcaacgcccctcagtcagcgattcttggaatgcacaatattgta
gaaagaccaatggcagttaacggagaagtaaaaatccttccaatgatgtacttggcactt
tcttatgaccacagaatcattgacggcagagaatccgtaagcttcctggtacgagtgaag
cagcttcttgaagacccgacgaggctgttgtttggagtctaa

DBGET integrated database retrieval system