KEGG   Belliella baltica: Belba_1362Help
Entry
Belba_1362        CDS       T02134                                 

Definition
DNA replication and repair protein RecR
Orthology
K06187  
recombination protein RecR
Organism
bbd  Belliella baltica
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bbd00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Belba_1362
DNA repair and recombination proteins [BR:bbd03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Belba_1362
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1444762..1445382
Genome map
AA seq 206 aa AA seqDB search
MNFPSKLIEDAVNEISRLPGIGKKTALRLALHLLKQNESVTTSLSQSITKLRTEIKYCQI
CHNISDADTCSICMSQRRNRKIICVVEEIPDVLAIENTSQYDGLYHVLGGVISPIQGVGP
DELKIDSLFSRITISDQDNHVEEVILALPATMEGDTTSFYITRKLKEYGVKVSTIARGIP
VGGELEYTDEVTLGRSILTRVNYSAD
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
gtgaatttcccttcaaaattgatagaagatgctgtaaatgaaatcagccgcctccctgga
ataggcaaaaaaacagcattaaggctcgctttacaccttctcaagcagaacgaatctgta
acaacatcactttctcaatcgatcacaaaattgagaactgagatcaaatattgtcaaatc
tgccataatatttctgatgcagatacatgcagtatttgtatgagccagagaagaaatcgt
aaaattatctgtgtagttgaagaaatacctgatgtattggctattgaaaacacctcacaa
tatgatggtctctatcatgtgctaggtggagtaatctccccgatacaaggcgttggtcct
gacgaattaaaaattgactctttgttcagtcgaataactatttcagatcaagataatcat
gttgaagaagtaatattagcacttcctgctacgatggaaggtgatacaacttctttttat
attactcgaaagctcaaagagtatggcgtaaaagtaagtacaattgcgcgaggaattcct
gtaggaggagagttagaatatactgacgaagttaccttgggtcgaagtattttgacaaga
gtgaattattctgctgattga

DBGET integrated database retrieval system