KEGG   Belliella baltica: Belba_1681Help
Entry
Belba_1681        CDS       T02134                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
bbd  Belliella baltica
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:bbd00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1790535..1792025)
Genome map
AA seq 496 aa AA seqDB search
MPQYILSLDQGTTSSRAIVFDKKGQIISVAQKDFKQHFPKSGWVEHDPQEIWATQSAVMI
ESLANEGIKASEIAAIGITNQRETTVVWDRKTGKPLNNAIVWQDRRTSAYCDELRAEGKA
EVIAKKTGLILDAYFSATKIKWILDNVEGARERAEKGELAFGTIDTWLIWKLTSGKTHAT
DISNASRTMIYNIHEEKWDQELLQLFDIPENMLPEVKESSELIGETSGDILSHKIPISGV
AGDQQAALFGQLCTQSGMAKTTYGTGCFLVMNTGEKPVTSQNKLLTTVAWKINGKINYAL
EGSVFIGGAAIQWLRDGMEMFGQAKESEKLAISLDDNDGVYFVPALSGLGAPHWDQNARG
AFFGLTRGTTIAHMTRAALEAIAYQVNDVLKAMEKDSGEVTKELRVDGGATANNFLMQFQ
SDILGCKITRPKIIETTAIGAAFLAGLAVGFWKDEEELKSLWEADKSFEPIMDKEKVEKY
LHFWHKAVERSKNWVE
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgcctcaatacattttatccttagatcaaggaacgacgagttctagagcaatcgttttt
gataagaaaggacaaattatctctgttgctcaaaaagattttaaacagcattttcccaaa
tcaggatgggtagagcatgatccacaagaaatttgggctactcaatcagcagtgatgatc
gaatctcttgccaatgaaggcatcaaagcttctgaaattgcagctatcggaattacgaat
caaagggaaacaactgtagtttgggataggaaaaccggtaaaccattaaataatgccata
gtatggcaggacagaagaacatccgcttattgtgatgaattgagagcggaagggaaagct
gaagtcattgcaaaaaaaacaggtttaattctcgatgcttatttttctgctactaaaatc
aaatggattttggataatgttgaaggcgcaagagaacgtgctgagaaaggtgaattggct
tttgggacaatcgatacttggctgatttggaaacttacaagtggcaaaacccatgcgacc
gatatcagtaatgccagccgaacaatgatttataatattcatgaagaaaaatgggatcaa
gaactccttcagctcttcgatatccctgaaaatatgcttcctgaagtcaaagaaagttct
gaacttataggtgagacttcaggggatattctttcgcacaagatcccgatttctggagta
gccggagatcagcaggcagcacttttcggacaactttgtacgcaatcagggatggccaag
accacttatggtacaggctgttttcttgtcatgaatactggtgaaaagccagtgacttca
caaaacaaactactcacgactgtagcttggaaaatcaatggaaaaatcaactatgcatta
gaaggatctgttttcattggaggtgcagcaatacaatggttgcgagatggaatggagatg
tttggacaagccaaggaaagtgaaaagttagcaatcagtctggatgataatgatggagta
tattttgttccagccctctcaggacttggagcaccacattgggatcagaatgcaagaggg
gcattttttggactaacccgtggaacgaccatcgcacacatgacacgtgctgctttggaa
gccattgcttaccaagtcaatgatgtcctcaaagccatggagaaagacagtggagaagtc
accaaagaactccgtgtagatggaggcgcaactgcaaataatttcctaatgcaattccaa
tccgacattttaggctgcaaaattactcgaccaaaaataatagaaactactgccattgga
gcggcatttttagcaggactggccgttggattttggaaagatgaagaggaactcaaatcc
ttatgggaggcagacaaaagctttgagccaattatggataaggaaaaagtcgaaaaatat
ctacatttttggcataaggcagttgaaagatctaaaaattgggtcgaataa

DBGET integrated database retrieval system