KEGG   Belliella baltica: Belba_1761Help
Entry
Belba_1761        CDS       T02134                                 

Definition
galactose mutarotase (EC:5.1.3.3)
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
bbd  Belliella baltica
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bbd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Belba_1761
   00052 Galactose metabolism
    Belba_1761
Enzymes [BR:bbd01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     Belba_1761
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1862317..1863465
Genome map
AA seq 382 aa AA seqDB search
MKKMNFKSITILFSALLIGIWSCSSPKTEEKEEMKKEIKFKVKVQEVPVGDQTAKVFHLE
NGNGMEVELSSFGAVVSKLIVPDRDGKSENIVLGYESIDGYDTNDYYLGATAGRYANRIA
KGKFEIDGSSYQVTTNDGNNHLHGGNFGFNRKNWDAEFIEGEESMKVKMTYTSPDGEEGF
PGELVSTVIYELTADNKLLISFEATTDKPTIVNLTHHGYFNLSAMKEDILGHELKINAAK
YTPVDNELIPTGELKDVSGTPFDFNTPTTIGARISEIQGGYDHNYVVKEQHDGQLTKMAE
LYHAGSGRVMELYADSPAVQFYSGNFLDGGLTTNGVTYSQYMGLCLEPQTFPNAPNEPSF
PSARLNPGEKYSHKIELHFGVR
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatgaatttcaaatcaatcaccattttgttctccgcccttttaatcggaata
tggagttgttcttcgcctaaaacagaggaaaaagaagaaatgaaaaaagaaatcaaattt
aaagtcaaagtacaggaagttcctgtaggagatcagacagccaaggtttttcatttagaa
aatggaaacggaatggaagtagaactttcaagttttggagctgtagtttcgaagttgatc
gtgccggatagagatggaaaatctgagaacattgttttaggatacgagtcaattgatggg
tatgacaccaatgactattacctaggggcgactgctgggagatatgcaaacaggatcgct
aaaggtaaatttgaaatcgacggatctagctatcaagtaaccaccaatgatggaaataac
caccttcatggaggtaattttggcttcaatcgtaagaattgggacgctgaatttattgaa
ggcgaagagtctatgaaagtcaaaatgacttacacgagtcctgatggtgaagaaggtttt
cctggagagttggtctctacagtcatctatgaattgacagctgataataaactattgatc
agttttgaagcgacaacagataaaccaaccatcgtaaacttgacgcatcatggatacttc
aaccttagtgcgatgaaagaggatattcttggacatgaattgaaaatcaatgctgcaaaa
tacactcctgtggacaatgaattaattcctacaggggaacttaaagatgtatctggaact
ccatttgacttcaacacaccaacgacaatcggtgctagaatctcagaaatacaaggagga
tacgatcacaattatgtggtaaaagagcagcatgacggtcagctgacaaaaatggctgaa
ttgtatcatgcgggttcaggaagagtgatggagctttatgcggattcacctgctgtacag
ttttattctggtaatttcttagatggcggattgactaccaatggcgttacatattctcag
tatatgggactttgccttgagccgcagacatttccaaatgcgccaaatgaaccctctttc
ccatctgcaagacttaatccaggcgaaaaatacagccacaagattgagctacactttggt
gttagataa

  All links  
No link information was found.   
DBGET integrated database retrieval system