KEGG   Belliella baltica: Belba_1927Help
Entry
Belba_1927        CDS       T02134                                 

Definition
lysophospholipase L1-like esterase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
bbd  Belliella baltica
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:bbd00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Belba_1927
Enzymes [BR:bbd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Belba_1927
   3.1.2  Thioester hydrolases
    3.1.2.-  
     Belba_1927
Lipid biosynthesis proteins [BR:bbd01004]
 Fatty acid synthase
  Component type
   Belba_1927
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2046092..2046769)
Genome map
AA seq 225 aa AA seqDB search
MKSSFNILYITLGLILLSCSSPKVEISNPITEPETTSPAPDKKLILFFGNSLTAGYGIEA
EDSFPGLVAARIDSLDLEYRVINGGLSGETTASGLSRLDWFLEEKPSVFVLELGGNDGLR
GIDLSETKKNLKAIIQLVRSKYPETKILLAGMQIPPNMGQDYTMEFQKLYPQVAEEEDVE
LIPFLLEGVAGNPDLNLPDGIHPTEEGHLIVFENIWPFIEEMIER
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcatcattcaacatcttatacattaccctaggcttaatcttgctttcttgttct
tctccaaaggtagaaatatctaatccaataacggaaccagaaactacatcccccgcaccg
gataaaaaacttattctattttttggaaatagtttaacagcaggctatggcatagaggca
gaggattcttttccaggtttagtagcggctcgaattgatagccttgatttagaataccga
gtaatcaacggtggattaagtggcgaaactaccgcaagtggtctaagtcggctggattgg
tttttagaggagaagccttcagtttttgttttagaattaggaggaaatgacggtttgaga
ggaattgatttatctgagaccaaaaaaaatctcaaggcaattattcagctagtgagaagt
aaatatcctgaaacaaaaattttgctcgcaggtatgcaaatccctcctaatatgggtcaa
gattatacaatggaatttcagaagctttatccacaagttgccgaagaagaagatgtggaa
ttaattccttttcttttggaaggagttgcaggaaacccagaccttaaccttcccgatgga
attcatccaacggaagaaggtcatctaattgtttttgaaaatatctggccctttattgaa
gaaatgattgagagataa

DBGET integrated database retrieval system