KEGG   Belliella baltica: Belba_1927Help
Entry
Belba_1927        CDS       T02134                                 

Definition
lysophospholipase L1-like esterase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
bbd  Belliella baltica
Pathway
Biosynthesis of unsaturated fatty acids
Class
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:bbd01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2046092..2046769)
Genome map
AA seq 225 aa AA seqDB search
MKSSFNILYITLGLILLSCSSPKVEISNPITEPETTSPAPDKKLILFFGNSLTAGYGIEA
EDSFPGLVAARIDSLDLEYRVINGGLSGETTASGLSRLDWFLEEKPSVFVLELGGNDGLR
GIDLSETKKNLKAIIQLVRSKYPETKILLAGMQIPPNMGQDYTMEFQKLYPQVAEEEDVE
LIPFLLEGVAGNPDLNLPDGIHPTEEGHLIVFENIWPFIEEMIER
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcatcattcaacatcttatacattaccctaggcttaatcttgctttcttgttct
tctccaaaggtagaaatatctaatccaataacggaaccagaaactacatcccccgcaccg
gataaaaaacttattctattttttggaaatagtttaacagcaggctatggcatagaggca
gaggattcttttccaggtttagtagcggctcgaattgatagccttgatttagaataccga
gtaatcaacggtggattaagtggcgaaactaccgcaagtggtctaagtcggctggattgg
tttttagaggagaagccttcagtttttgttttagaattaggaggaaatgacggtttgaga
ggaattgatttatctgagaccaaaaaaaatctcaaggcaattattcagctagtgagaagt
aaatatcctgaaacaaaaattttgctcgcaggtatgcaaatccctcctaatatgggtcaa
gattatacaatggaatttcagaagctttatccacaagttgccgaagaagaagatgtggaa
ttaattccttttcttttggaaggagttgcaggaaacccagaccttaaccttcccgatgga
attcatccaacggaagaaggtcatctaattgtttttgaaaatatctggccctttattgaa
gaaatgattgagagataa

DBGET integrated database retrieval system