KEGG   Belliella baltica: Belba_1979Help
Entry
Belba_1979        CDS       T02134                                 

Definition
(GenBank) nitrous oxide reductase
  KO
K00376  nitrous-oxide reductase [EC:1.7.2.4]
Organism
bbd  Belliella baltica
Pathway
bbd00910  Nitrogen metabolism
bbd01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bbd00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    Belba_1979
Enzymes [BR:bbd01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.2  With a cytochrome as acceptor
    1.7.2.4  nitrous-oxide reductase
     Belba_1979
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RsgA_N Cupredoxin_1 COX2
Motif
Other DBs
NCBI-ProteinID: AFL84554
UniProt: I3Z5N6
Position
complement(2100445..2102397)
Genome map
AA seq 650 aa AA seqDB search
MKTKLWLLAGAMVAIAFAPGCKPKGAQSALSGDAASKVYVAPGEHDEFYNIVSGGFNGQM
SVVGLPSGRVFKILPVFSVHPENGYGFSEESKPMLNTAHGFVPWDDLHHIAISTTNAEHD
ARWAFGNANNTPRIARVDLTTFKTVEIIEIPNSAGNHSSPFITENTEYVVAGTRFSVPTG
DNRDLPIETYKENFKGTISFISVDKEHGNMDLAFQIEAPPFNFDLARAGKKKSHGWFFFS
TYNTEMAHTLLEVNASQKDKDFIMAVNWKKAEQYIKEGKGKKTKAKYAHNVWDEDTHMAT
STIKEDILTLDPKELKDIIYFIPCPKSPHGTDTDPTGEYIIGSGKLAAIIPVFSFTKMLN
AIENQDFEGTIDGMPVLKYESVLHGEVEKPGLGPLHTEFDGQGNAYTSMFVSSEIVKWNI
ETLQVLDRVPTYYSVGHLMIPGGPTGKPHGKYMVAYNKITKDRYLPTGPELAHSAQLYDI
SGDKMQLLLDFPTIGEPHYAEAFPASLIKDKQVKFYPLEKNNHPRALKGINNARVEREGN
KVHIYMTTIRSNFRPDNIEGVRVGDEVYFHVTNLEQDWDVPHGFAVKGANTAELLVMPGE
TATLKWMPDRVGIFPFYCTDFCSALHQEMQGYLRVSPAGSDPEIKFSTGE
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacaaaattatggttattggcaggagctatggtggccatagcatttgccccgggc
tgtaaaccaaaaggtgctcaatcagccctttctggtgatgctgccagcaaagtttatgta
gctccaggagagcacgatgaattctacaatatcgtctccggaggtttcaatggacaaatg
tccgtcgtaggtcttccttcaggaagagtttttaaaattttacctgtattctctgttcat
ccagaaaatggctatggcttctcagaagaatccaaacctatgctaaatacagcacatggt
tttgtcccttgggatgacttgcaccacattgccatttctactaccaacgcggagcatgat
gcaagatgggctttcggcaatgctaataatacgcctagaatagcgagggtagatttgaca
acattcaaaacggtcgaaattattgaaatcccaaactctgccggaaaccactcctcccct
ttcattactgaaaacacagaatatgtggtagctggaacccgattctctgtcccaacagga
gacaatagagatctgcctatagaaacctataaagagaacttcaaaggtacgatttcattt
atttcagttgataaagaacatggaaacatggatttggctttccaaatcgaagctccacct
ttcaattttgatttggctcgagcaggcaagaaaaagtcacatggctggttctttttctct
acttacaacaccgagatggctcatacacttttggaagtaaatgcttcacaaaaggacaag
gacttcatcatggctgtaaactggaaaaaagcagaacaatacatcaaagaaggaaaaggc
aaaaaaaccaaggccaagtatgcacacaatgtttgggatgaagatacccacatggctact
tctaccatcaaggaagacattctgactttggatccaaaagaactgaaagatatcatctac
tttatcccttgtccaaaatctccacacggtacggatactgacccaactggagagtatatc
attggttcaggaaaattagccgcgatcattcctgtcttctctttcacaaaaatgcttaat
gctattgaaaaccaagacttcgagggtactattgatggcatgccagttttgaaatatgaa
tctgtactgcatggggaagtagaaaaaccaggtcttggccctcttcacacggaatttgat
ggacaaggaaatgcatacacttccatgtttgtttcttctgaaatcgtaaaatggaacatc
gaaacccttcaggttttggatagagtacccacttactattcagtgggtcacttgatgatt
cctggtggaccgacaggaaaaccacatggaaagtatatggtagcctacaacaaaatcaca
aaagatagatacttgcctacaggtcctgaattggctcactctgctcaactatatgacatc
tcgggggacaaaatgcagctgctgcttgacttcccaactatcggtgaacctcactatgct
gaagctttcccagcctctttgatcaaagacaagcaggtgaagttctatcctttagaaaaa
aacaatcacccaagagcactcaaaggtatcaataatgcccgcgtggagcgtgaaggcaac
aaggtccatatttacatgaccaccatcagatccaacttcagaccagacaatatcgaaggc
gtcagagttggagacgaagtttacttccacgtgaccaatttggaacaagactgggatgtg
ccgcatggttttgcagtgaaaggtgctaatacagcagaattacttgtaatgccaggagaa
acagcaacgctcaagtggatgccagatagagttggaatattcccattctactgtactgac
ttctgctctgccctgcaccaagaaatgcaaggatacctccgcgtatctccagcaggaagc
gatcccgaaatcaaattctctacaggcgaataa

DBGET integrated database retrieval system