KEGG   Belliella baltica: Belba_2184Help
Entry
Belba_2184        CDS       T02134                                 

Definition
beta-1,4-xylanase
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
bbd  Belliella baltica
Brite
Enzymes [BR:bbd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     Belba_2184
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2333347..2334465)
Genome map
AA seq 372 aa AA seqDB search
MKPFHIKSLLFSLTLLLSFDTVSSQSLKKSYEQFFDIGAAIGVREASGTEKRAYPILDKH
FNSLTPENLMKWGSIHPRLEEYNFGPMDNLVELAEKLDARVVGHTLVWHNQTPNWVYEDE
NGELLSKEALLLRMEDHISNVVSRYKGKVHGYDVVNEAFFDDGQYRTSKWYNAAGKDFIK
RAFIKANEIDPNTELYYNDYNMWKPEKRDAAIELAKELREEGIRIDGIGMQGHYGLESPS
IEIIEASIVKIAEAGFKVMFTEVDIDVLPNPVNRHGADIDATFPADEKYNIYKEGLPEEV
QKQLVQRYKELFELFKKHEDKITRVTFWGVHDGGSWLNNWPMPGRTAYPLLIDKDFKEKK
DIIDALIKVAEK
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccatttcacataaaatcacttttatttagccttacacttttactcagttttgac
acggttagtagtcaatctttgaaaaagagctatgaacaattcttcgatattggagcagca
ataggagttagagaagctagtggaacagaaaaaagagcttacccaattttagataaacac
ttcaatagcctcactcccgaaaacttaatgaaatggggttccattcacccaagattggag
gaatataattttggtcctatggacaatttggttgagttggctgaaaaattagatgcgcga
gtagtaggacatacacttgtttggcataatcagactccaaattgggtttatgaagatgaa
aatggcgaacttctttcaaaagaagctttgctgctgagaatggaagatcatatttcaaat
gtagtcagcaggtacaaaggaaaagttcatggctatgatgtagtcaacgaagcgtttttt
gatgatggacaatacaggacttcaaaatggtacaatgcagctggaaaagattttatcaaa
agagcatttatcaaagcaaatgaaattgatccaaacacagagttgtactacaacgattac
aatatgtggaagccagaaaaaagagatgcagccattgaactggcaaaagaacttagagaa
gaaggaattagaatcgatggaattggcatgcaagggcattacggattagaatctcctagc
atcgaaatcatcgaagcttcaatcgtaaaaattgcagaagctggcttcaaggtcatgttt
acagaagtggatattgatgtgctgccaaatcctgtcaacagacatggcgcagatatcgat
gctacctttcccgcagacgaaaaatataatatttacaaagaaggattacctgaggaagtt
caaaagcagttggttcaacgatacaaggagttatttgagcttttcaaaaaacatgaagat
aagataactcgagttacattttggggagtgcatgatggtgggagttggctcaataactgg
cctatgccaggaaggacggcttatccactattgatagataaagactttaaagaaaaaaaa
gacatcattgatgctttgatcaaagtagccgagaaataa

DBGET integrated database retrieval system