KEGG   Belliella baltica: Belba_2231Help
Entry
Belba_2231        CDS       T02134                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
bbd  Belliella baltica
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:bbd00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Belba_2231
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Belba_2231
Enzymes [BR:bbd01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Belba_2231
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2381857..2382444)
Genome map
AA seq 195 aa AA seqDB search
MKKLLTILAFIAFACTSSVQKDNKEVSSNITLDQMLMEKSIYDFKLNDIDGNEVDFNQFK
GKKLLLVNVASKCGYTPQYADLQKLNEEYGDQVVILGFPANNFGGQEPGTNEDIKQFCSA
NYGVTFKMFDKISVKGADKHPLYRWLSDKDMNGWNDKEPTWNFCKYFIDENGELKKFFAS
SVNPMDQEIIQLIKS
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaactacttactattttggcttttatcgcctttgcttgcacttcaagtgtacaa
aaagataacaaagaagtatcttcaaacatcaccttagaccaaatgctcatggaaaaatca
atatatgatttcaaattaaatgatattgatggtaatgaagttgacttcaaccaattcaaa
ggtaaaaagctgcttttggtaaatgtcgcatcaaaatgtggctacactcctcaatatgct
gatttacaaaaattaaatgaagaatatggagatcaagtagtgattctaggatttcctgct
aataattttggtggacaagagccaggaactaatgaagacatcaaacaattctgtagtgcc
aactatggagtaacattcaaaatgttcgataaaatctctgtgaaaggtgcagataagcat
cctctttatagatggttatctgataaagacatgaatggttggaatgacaaagaacctacc
tggaatttttgcaaatattttattgatgaaaatggggaattaaaaaaattctttgcatct
tcggtaaatccaatggatcaagaaattatccaattaataaaatcttaa

DBGET integrated database retrieval system