KEGG   Belliella baltica: Belba_2233Help
Entry
Belba_2233        CDS       T02134                                 

Definition
arginase (EC:3.5.3.1)
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
bbd  Belliella baltica
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bbd00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Belba_2233
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Belba_2233
Enzymes [BR:bbd01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Belba_2233
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2384356..2385306)
Genome map
AA seq 316 aa AA seqDB search
MRNIKLVEVRSEIAAGTRGASLGIDALKIASLDKKSNFFTKFDPINVPDANNFLWRGNKH
PHAKYIDGVYQVLKNVSSTIESLRLEKKFPIVLAGDHSTAAGTIMGIKAAHPEKRLGVIW
IDAHADLHTPYTTPSGNMHGMPLAMCLKEDNLENCINEPAEETIQYWDKIKKIGGDFPKI
SPKDIVFITVRDTEEPEDNLIAKHQIKNFTTEEVREKGVTLIAKEALEVLKECEQIYISF
DVDSLDSSISVGTGTPVANGLTVEEAIQLNTELIKDKRVCCWEIVEVNPTLDTENLMAEN
AFEVLESTTRSLVDNF
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgagaaacatcaaattagtagaagtacgttctgaaatcgctgctggaactagaggagca
agcttgggaatcgatgcattgaagattgctagtttagacaaaaaatctaatttttttaca
aaatttgacccaatcaatgttcccgatgcaaacaattttttgtggagaggaaataagcat
cctcatgccaaatacatcgatggtgtctatcaagtattgaaaaatgtatcaagtaccatt
gaatcccttcgtttggagaaaaaatttcccatagtactcgcaggtgatcattcaacagct
gcagggacgattatgggaatcaaagcagcccaccctgaaaaaaggcttggtgtcatttgg
atagatgcccatgctgatttacatacaccttatactacgccctctggcaatatgcatggc
atgccattggcgatgtgcttgaaagaagacaatcttgaaaattgcattaatgaaccagca
gaagagacgattcaatactgggataaaatcaaaaaaattggcggggattttccaaaaatc
agcccaaaagacattgttttcataactgttagagatacagaagagcctgaagataatttg
attgccaagcatcaaattaaaaatttcactactgaggaggttagagaaaaaggagtgaca
ttaatagcaaaagaagctttagaagttctcaaagaatgtgagcaaatctatatttcgttt
gatgtggatagtttagatagttctatatcagttggaactggaactcctgtcgcaaatgga
ctgacagtcgaagaagctatacagctcaatactgaattaattaaagacaagagagtttgc
tgttgggaaatcgtagaagttaatcctactttagatacagaaaatctaatggcagaaaat
gctttcgaagtcctagagtctactactagatcgctcgtagacaacttctaa

DBGET integrated database retrieval system