KEGG   Belliella baltica: Belba_2465Help
Entry
Belba_2465        CDS       T02134                                 

Definition
(RefSeq) succinyl-CoA synthetase subunit beta
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
bbd  Belliella baltica
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bbd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Belba_2465
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Belba_2465
   00640 Propanoate metabolism
    Belba_2465
   00660 C5-Branched dibasic acid metabolism
    Belba_2465
Enzymes [BR:bbd01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Belba_2465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2633261..2634472)
Genome map
AA seq 403 aa AA seqDB search
MNIHEYQAKEVLKSYGVRIQEGIVAETPEAALEAAKKLNAETGTSWYVIKAQIHAGGRGK
GKVQETDSNGVVLAKKLEDVAEKAKNILGGTLVTHQTGPEGKKVNKVLIAEDVYYPGDSE
PKEYYLSILLDRAKGSNVIMASTEGGMDIEEVAENHPEKIIKEWIDPKVGLQGFQARKVA
FKLGLEGNAFKEMVKFITALYAAYEGTDSSQFEINPVLKTSDNKILAVDAKVNLDDNALY
RHKDLADLRDLAEEDPLEVEAGESGLNYVKLEGNVGCMVNGAGLAMATMDMIKLSGGEPA
NFLDVGGGANATTVEAGFRIILKDPNVKAILINVFGGIVRCDRIANGVVEAYKSIGDISV
PIIVRLQGTNAEEGARIIDESGLKVSSAITLKEAAEKVKSAIA
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgaatatacacgaatatcaagcaaaagaagttttaaagagttatggtgttagaattcag
gaaggcatcgtagcagagacccctgaagcagcactcgaagcagccaagaaactcaatgca
gagacaggcacttcatggtatgtgatcaaagcacaaatccatgccggtggacgtggaaaa
ggcaaagttcaagaaactgactccaatggtgtggtacttgccaaaaaattggaagatgta
gctgaaaaagccaaaaacatccttggaggaacattggtaacgcaccaaacaggtccagag
ggcaaaaaagtaaataaagtcttgatcgctgaggatgtatactatccaggtgattcagaa
ccaaaagaatattacctatctatccttcttgacagagcaaaaggtagcaacgtgatcatg
gcttctacagaaggtggtatggatatcgaagaagtagcagaaaatcatccagagaaaatt
atcaaagagtggattgacccaaaagtaggacttcaaggcttccaagctagaaaagttgct
ttcaaactaggtttggagggcaatgcattcaaagaaatggtgaagttcatcactgcgctt
tatgcagcttatgaaggaactgattcttctcagtttgagatcaaccctgtattgaaaaca
tcagacaataagatcttggcagtagacgccaaagtaaacttggatgacaacgcactttac
agacacaaagacctagctgatcttagagacttggctgaagaagatcctttggaagtagaa
gcaggagaatcaggcttgaactatgtaaagcttgaaggaaacgtaggctgcatggtaaat
ggagctggacttgctatggctaccatggatatgatcaaactttctggtggtgaacctgcc
aacttccttgatgtaggaggaggagctaatgctactactgtggaagcagggtttagaatt
atcttgaaagatccaaatgtaaaagccatcttgatcaacgtatttggtgggatcgtaaga
tgtgatagaattgccaatggtgtagttgaagcttacaaatcaatcggagacatcagcgtt
cctatcatcgtaagacttcaaggaacaaatgctgaagagggtgctagaatcattgacgaa
tctggcttaaaagtatcttctgcaatcactttgaaagaagctgctgaaaaagtaaaatca
gcaatcgcttaa

DBGET integrated database retrieval system