KEGG   Belliella baltica: Belba_2478Help
Entry
Belba_2478        CDS       T02134                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
bbd  Belliella baltica
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bbd00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Belba_2478
Enzymes [BR:bbd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Belba_2478
Exosome [BR:bbd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Belba_2478
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2648100..2649599
Genome map
AA seq 499 aa AA seqDB search
MEKYVLAMDQGTTSSRSIIFDKSGNIISVAQKEFTQIFPKPGWVEHDPIEIWSTQAAVTA
EATAKVGLNGKNLAAIGITNQRETVLVWEKKTGQPIYNAIVWQDKRTSDYCEKLKSDGKE
KIVREKTGLVLDPYFSGTKIKWILDNVEGARERAQNGELVCGTIDTWLVWNLTKGETHVT
DVSNASRTLLFNINTLQWDDELLQLFDIPKAILPEVKESSEIYGHTKTTIFASKIPISGI
AGDQQAALFGQQCTQTGMVKNTYGTGCFMLMNIGDKPIISKNGLLTTVAWSINGKTQYAL
EGSIFIGGAVVQWLRDKLGVILSSKQVEELAGKVEDTEGVIFVPTFAGLGAPYWNSYARG
TLFGLTRNTSDAHIARAALDAIAYQTMDVLHAMQADSGLKIRELRVDGGATVNNLLMQFQ
SDVMDTNVIRPKVTETTALGAAYLAGLAVGYWKNTEEISEFWVKDRVFEPNPDRSKVEVG
IENWHHAIKTIQFWTNKDF
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagtatgttttagccatggaccagggaactacgagttcccgttccataattttt
gacaagagtggcaatatcatatcggttgcccaaaaggaatttacacagatatttcccaaa
ccaggttgggtagagcatgatcctatagaaatctggtcaactcaagctgccgtgacggca
gaggctactgctaaagttggtctaaatggtaaaaatttagctgctattgggattacaaac
caaagagaaacagttttggtttgggaaaaaaagacaggccagccgatttacaatgctata
gtttggcaagataaacgtacgtcagattattgcgaaaagctcaaaagtgatgggaaagaa
aaaattgtgagagaaaaaacaggtttggttttagatccctatttctctggaacaaaaatt
aaatggattttagataatgtcgaaggggcacgagaaagagcccaaaatggagagctcgta
tgtggtactatagatacttggctcgtttggaatctcactaaaggggaaacacacgttact
gacgtcagtaatgcttctagaacgttattgtttaacataaacacgcttcaatgggatgat
gagcttcttcagctttttgacattccaaaagcaattttgccagaagtaaaagagagtagt
gagatttacggtcataccaaaaccacaattttcgcttccaaaatacctatctcgggtata
gcaggtgatcagcaggcagcattgtttggacaacaatgtacccaaactggaatggtgaaa
aatacctatggaactggttgttttatgctcatgaatattggtgataagccaattatttcc
aaaaacggactgttgactacagtagcatggtctataaacggaaagacccaatatgccttg
gaagggagtatttttataggtggggcagttgttcaatggcttagggacaagctaggagta
attctgagttccaaacaagtagaagaactagcaggaaaagtggaagatactgagggtgtt
atttttgtgccgacttttgccgggttaggtgctccatactggaactcttatgccagagga
actctatttggattgacaaggaatacatcagatgctcatattgctagagctgctttggat
gcaattgcttatcagacaatggatgtactgcatgcaatgcaagctgatagtggattgaaa
atcagagaactccgagtagatggaggggctacagtcaacaacttgctgatgcaattccaa
tctgatgtaatggataccaatgtgatccgtcccaaagtaacagaaacaacagcgctcggt
gctgcatatttggcaggtttggctgttggctattggaagaatactgaggagattagtgag
ttttgggtcaaagatcgagtttttgaaccaaaccctgatagaagtaaggttgaagttggt
atcgagaattggcatcatgcaattaagacgatccaattttggacaaacaaagatttttaa

DBGET integrated database retrieval system