KEGG   Belliella baltica: Belba_2483Help
Entry
Belba_2483        CDS       T02134                                 

Definition
nicotinamidase-like amidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
bbd  Belliella baltica
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bbd00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Belba_2483
Enzymes [BR:bbd01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     Belba_2483
    3.5.1.-  
     Belba_2483
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2654322..2654933
Genome map
AA seq 203 aa AA seqDB search
MKALIIVDVQNDFLPGGALAVAEGDQIIPIVNGIQAKFDFIVATQDWHPEDHGSFAINHP
DKNVGDFVDLNGVNQILWPVHCVQGSFGAEFHADLNQDNWQAIFRKGTNPKVDSYSGFFD
NNRQGDTGLSKFLKDQGVQEIFVCGLAEDYCVKFTVLDGLAEGFDVYLILDATRAVNIHP
DDFSKAMIEMENAGATITHSDSI
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcattaataatagtagatgtacaaaatgattttcttcctggaggggctttagcc
gtcgcagaaggggatcagatcattccaatagttaatggaattcaggctaagtttgatttt
atcgtcgctactcaagactggcatcctgaagatcatggaagttttgcaatcaatcatccc
gataaaaatgtcggtgactttgtagatctgaatggcgtcaatcaaatcctgtggcctgtg
cattgtgttcaagggagctttggagcagaattccatgctgatctgaatcaagataattgg
caggcgatttttcgaaaagggacaaacccaaaggtggattcttattctggtttttttgat
aacaatagacaaggagatactggcttaagcaagttccttaaagatcaaggagttcaggaa
atctttgtttgcggattggcagaagattactgtgtgaaattcaccgttttggatgggttg
gctgaggggtttgatgtgtatttgattttggacgctacacgcgccgtgaacatccatcct
gatgatttctcaaaagccatgatagaaatggaaaatgctggagcaacaatcactcattct
gattccatttga

DBGET integrated database retrieval system