KEGG   Belliella baltica: Belba_2493Help
Entry
Belba_2493        CDS       T02134                                 

Definition
pectin methylesterase
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
bbd  Belliella baltica
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bbd00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Belba_2493
   00500 Starch and sucrose metabolism
    Belba_2493
Enzymes [BR:bbd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     Belba_2493
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2664754..2665770
Genome map
AA seq 338 aa AA seqDB search
MKKALIFILLTLISKISFAQESDFVVSQDGSGDFVTVQEAIMAVPDFRNVPTYIFIKSGI
YKEKIILPTSKTKVVLIGEDVENTILTFDDFASKLNKFGEEMGTTGSSSFFVFGDDFSAR
NLTFANSSGPVGQAVAIRVTGDRAFFEKCKFLGFQDTLYAHGEKSRQYYKDCYIEGTTDF
IFGWSTAVFENCEIFSKAGGQYITAASTLESVPNGFVFINCKLTGDAPEGKVYLGRPWRI
HAKTVFINTEMGKHIRPEGWHNWNKPEAEATAFYAEFGSSGEGAHPSARVSWSKQLTEEE
MSKFTVENILSGSDGWIPGINLENKLWPSPHHLPKSKD
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagcgctgatctttatacttctaactttaatcagtaaaatttcttttgcacaa
gagagcgattttgtcgtgtcccaagatggttctggagattttgtgacagtccaagaggcg
attatggcagtgcctgattttcgaaatgttccaacgtatattttcatcaaatcaggaatt
tataaggagaaaatcattcttcctacttccaaaactaaagttgttctgataggtgaagat
gtagaaaataccattttaacttttgacgattttgcctcaaaactcaataaattcggtgag
gaaatgggaacaacgggttcaagtagcttttttgttttcggagatgatttttctgcacgg
aatttgacatttgccaattcctcaggtcctgtcggacaagcggttgcaattcgggtgaca
ggtgatcgagcattttttgagaagtgtaaatttcttggattccaagacacgctctatgca
catggagaaaagagcagacaatactacaaagattgctacattgaaggaacgaccgacttt
atcttcggctggtcaacagctgtttttgaaaactgcgaaatattctccaaagcaggaggc
caatacatcactgcagcttcaactttggaatcggtacccaatggttttgtatttatcaat
tgtaaactcactggagatgctcctgaaggaaaagtttacttgggaagaccatggagaatt
catgccaagacagttttcatcaatacagaaatgggcaaacacattcgtcctgagggatgg
cacaattggaacaaacccgaagccgaagccactgctttttatgcagaatttggctcttct
ggagaaggggcacatccaagcgcgcgagtttcgtggtccaaacaactgactgaagaggag
atgagtaaattcactgttgaaaatatcctttctggttcagacggatggattcctggaata
aatctggaaaacaaactttggccatcgccgcatcatcttccaaaatctaaagattga

DBGET integrated database retrieval system