KEGG   Belliella baltica: Belba_2563Help
Entry
Belba_2563        CDS       T02134                                 

Definition
arginase family hydrolase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
bbd  Belliella baltica
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bbd00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Belba_2563
Enzymes [BR:bbd01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Belba_2563
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2743196..2744293
Genome map
AA seq 365 aa AA seqDB search
MSLKHQIIDSFDPNGVSTYNSLFGLPFDEITAELIIIPVPWEVTVSYSPGTADGPEAILN
ASMQVDLFQDDIKDAWKMGIHMLTIPEEIANKSSNFRILAKNYIDWLEKGAPEVELERFA
AVPDLINKASAEMNDWVYEQAKKYRSQGKMVALLGGDHSTPLGLIKALADDHDNFGILQI
DAHADLRVAYENFEYSHASIAYNALKFPQISKLVQVGIRDYCEAEAIMAKENNRITTFYD
KEIKKESYEGKAWKIICDEIVEQLPQEVYVTIDIDGFDPKLCPNTGTPVAGGFELDQIMY
LVREVVKSGRRLIGFDLVEVAPGPEGDEWDGNVGARILYRMANLYGASQGRLNLKYLNLI
GTLHL
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgtctttgaaacatcaaataatagatagttttgaccctaatggggtaagtacttataat
agtctttttggtctcccatttgatgaaattacagcagaattgatcatcattccagttccc
tgggaagtgactgtttcatattcacctggcacagccgatggccctgaggctattttgaat
gcttcgatgcaagtggatttatttcaagatgacattaaagatgcttggaaaatggggatt
catatgcttacgattcctgaagaaattgcaaataagagttctaactttagaatattagcg
aaaaattatattgactggttagaaaaaggagctcctgaagttgaattagaaagatttgct
gcagtaccagatttgatcaacaaggcaagtgctgagatgaacgattgggtctatgagcaa
gctaaaaagtatagaagtcaaggaaagatggttgcgctcttaggaggagaccacagcaca
ccattaggcttgattaaggcattagctgatgatcacgataattttggaatacttcagatt
gacgctcatgcagatctaagggtagcatatgaaaattttgaatactctcatgcatctata
gcttataatgctttgaagtttccacaaatcagtaaattggtacaagtaggtattagagat
tattgtgaagcggaggcgataatggctaaagagaacaatagaatcactacattttatgat
aaagaaataaagaaagaatcctatgaaggaaaagcttggaaaatcatttgtgatgaaatt
gtagagcaattaccacaagaagtttatgttactattgatattgatggatttgaccctaag
ctttgccctaatactggaacacccgtagctggtggttttgaattggatcaaattatgtat
ttggtgcgagaagtagtgaagtcagggagaaggttaattggatttgacttggtagaagta
gctccaggtccagaaggtgacgagtgggatggaaatgtaggtgctcgaattctttacaga
atggcaaatctttatggagcttctcaaggaagattgaatttgaaatatttgaatttaatt
ggtactcttcatctgtaa

DBGET integrated database retrieval system