KEGG   Belliella baltica: Belba_2616Help
Entry
Belba_2616        CDS       T02134                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bbd  Belliella baltica
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:bbd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Belba_2616
   01230 Biosynthesis of amino acids
    Belba_2616
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Belba_2616
   00030 Pentose phosphate pathway
    Belba_2616
   00051 Fructose and mannose metabolism
    Belba_2616
   00052 Galactose metabolism
    Belba_2616
  Energy metabolism
   00680 Methane metabolism
    Belba_2616
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Belba_2616
Enzymes [BR:bbd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Belba_2616
Protein phosphatases and associated proteins [BR:bbd01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Belba_2616
Messenger RNA biogenesis [BR:bbd03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Belba_2616
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2813169..2814260
Genome map
AA seq 363 aa AA seqDB search
MKKLLVCTGGGDCPGLNAVIRGIFKTAKKSKEWEVYGSIEAFNGVMADPIQIIKLTKSKV
GGIHVKGGTILKTTNKGNPLQFPVQDDNGNIVFEDRTDALAAKIKALGFDAVVNIGGDGS
QKISKALFDLGVPIIGVPKTIDNDLSATDTTFGFQTAVQIASDSFDKLVTTAESHHRVMI
MEVMGRDAGWIALHTAISGGAEICLIPEIPYDIQKVKEKIDSRYEKGRGFVNIVIAEGAK
AKGGQVFGSERENVSEHLRLGGVAFQLSQELKLAGCKPEIRETVLGHIQRGGTPVSYDRV
LATMFGVKAFDLVQNAQFGQMVSFKNNDYCSVSLEEAVRDYNVVDPEGFLIKGAKAMGMS
FGD
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaattacttgtttgtactggaggtggagattgtccagggttgaatgctgtgatt
agagggatttttaaaactgcaaaaaagtcaaaggaatgggaggtttatggtagcatagaa
gcttttaatggtgtcatggctgatcctatccaaatcatcaagctaacgaagtcaaaagta
ggggggattcatgtgaaaggcgggactattttgaagactacaaataaaggaaaccccctg
caatttcctgttcaagatgataatggaaatatagtatttgaagatagaactgatgcattg
gccgcaaaaataaaagctttaggctttgacgcggtagttaacattggaggagatggatct
caaaaaatttcaaaagccctttttgatttaggggttccgatcattggtgtgccaaagaca
attgataatgacctttcagcaactgacaccacttttggatttcaaacagccgtgcaaata
gcttcagatagttttgataagttagtgacaactgcggaaagtcatcatcgagtgatgatt
atggaagtgatgggtcgtgatgctggatggattgctttacatacggcgatttcgggtgga
gcagaaatctgtctaattcctgagattccttatgatatccaaaaagtgaaagaaaaaata
gatagcagatatgaaaaagggagaggatttgtcaacattgtgatcgcagaaggagcaaaa
gccaaaggcggacaagtatttggttcagaaagagaaaatgtctctgaacatcttcgacta
ggcggggtagcttttcagctttctcaagaattgaaactagctggctgcaaacctgaaatc
cgtgaaacagttttaggtcatattcaaagaggaggaactccagtgagttatgatagagtt
ttggcaaccatgtttggcgtaaaagcctttgatcttgttcaaaatgctcaatttggccaa
atggtttctttcaaaaataatgattattgttcagtgagtttagaagaagcagttcgtgat
tataatgtggtggatcctgaaggctttttaataaaaggagcaaaagcaatggggatgtca
tttggtgattaa

DBGET integrated database retrieval system