KEGG   Belliella baltica: Belba_2874Help
Entry
Belba_2874        CDS       T02134                                 

Definition
transcriptional regulator/sugar kinase
Orthology
K00886  
polyphosphate glucokinase [EC:2.7.1.63]
Organism
bbd  Belliella baltica
Pathway
Glycolysis / Gluconeogenesis
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:bbd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Belba_2874
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Belba_2874
   00520 Amino sugar and nucleotide sugar metabolism
    Belba_2874
Enzymes [BR:bbd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     Belba_2874
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3075546..3076199
Genome map
AA seq 217 aa AA seqDB search
MKILVIDIGGSNVKVRVNNGEERRKIPSGTFMTPQKMVEEVLKTTTDWEYEVISLGYPGV
IKDGKITAEPKNLGHGWMGFDFESAFGKPFKIMNDAAMQALGSYDKGVMLFLGLGTGLGS
ALVSHGHVVPMELAHLTYKKGVFEDYLGKKGFQHLGAAKWTKHVNTVVKRFTIAFIPDEI
VLGGGNSKHLTKTLPNCRLGNNQMAFEGGLRMWNNEG
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaatacttgtgattgatattggcggatccaatgtaaaagttagggttaataatgga
gaggaaagaagaaagataccttctggaacttttatgactcctcaaaaaatggtggaggaa
gtattaaaaactaccacagattgggaatatgaagttatttctttgggttatccgggagta
attaaagatggaaaaatcactgctgaacctaaaaatcttggacatggttggatgggtttt
gactttgagtcagcctttggcaaaccattcaaaataatgaatgatgctgcgatgcaagct
ttaggttcttatgataaaggagtaatgttgtttttaggtttaggtacaggtctaggctct
gcattggtaagtcatggacatgttgttccaatggaattagctcatttgacttataaaaaa
ggagtttttgaggattacttaggtaaaaagggttttcaacatctaggagcagccaagtgg
acaaaacatgtaaatactgtcgtaaaaagatttaccattgcttttatcccagatgaaatt
gtcttaggtggcggaaactcaaagcatttgactaaaaccctaccaaattgtagattagga
aataatcaaatggcatttgaaggcggcttgagaatgtggaataatgaaggttag

DBGET integrated database retrieval system