KEGG   Belliella baltica: Belba_2883Help
Entry
Belba_2883        CDS       T02134                                 

Definition
1,4-alpha-glucan-branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
bbd  Belliella baltica
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bbd00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Belba_2883
Enzymes [BR:bbd01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Belba_2883
Exosome [BR:bbd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Belba_2883
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3086310..3088322)
Genome map
AA seq 670 aa AA seqDB search
MKDAKILPLVQDESWLKSHADAVYERFVRYQSAIRDINSHSGSILEFARSHEYYGFHFEK
LRNGWVYREWAPQAHNLFLMGDFNHWNKYSHPMKRNYRGDWEVFLPYEEYKDSFVHGSKV
KVHVEADNGAYDRIPAYIRKVDQNPENHDFAGQIWFPKKEFAWTDQKFSSKSQKKCPLIY
ECHIGMAQEKEGVGTYLEFAENILPRIKAAGYNTIQMMAIMEHPYYGSFGYHVSNFFAPT
SRFGDPEDLKFLINKAHQYGIAVIMDIVHSHAVKNINEGLNEFDGSENQYFHPGPKGYHE
GWDSKLFDYGKFEVQQFLLSNIRYWMEEFHFDGFRFDGVTSVIYYHHGHTDFDHPDKYFN
DGVDQDALLYLQLANTLIHTFSESKISIAEEVSGMPGLCRECEDGGIGFDFRLAMGIPDF
WIKTMKHKPDEHWDMFEMWHELTNRPKNERTIAYAESHDQALVGDKSIAFWLMDKEMYFN
MGIDDKNLVVDRGIALHKMIRLITISLGGEGYLNFIGNEFGHPEWVDFPREGNNWSYQYA
RRQWSLADNESLKYKQLGLWDKAMIKLIDEFKVLSASHAQQIYLDAEKKILAYERADLIF
IFSFNISESFFGYELTLPKVGDYLNILNSDDSKFGGFDRIDNKIHYSTNKNGVIKLYLPN
RTCMVLKKIE
NT seq 2013 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagacgctaaaatacttccattagttcaagatgaatcatggcttaaatcccatgca
gatgccgtttatgagaggtttgtaagatatcaatcagctattcgagatataaattcacac
agtggaagtatcttagaatttgcgagatcccatgagtactatggatttcactttgaaaaa
ctcagaaatggatgggtttatagagagtgggcacctcaagctcataatttatttttgatg
ggtgatttcaatcattggaataaatacagccatccaatgaaaagaaattacagaggtgat
tgggaggtttttttaccttatgaagagtataaagattcttttgttcacggaagcaaagta
aaagtacatgtagaagctgataatggtgcttatgacaggattccagcttatatcagaaaa
gtagatcagaatcctgaaaaccatgattttgcaggtcaaatatggtttcccaaaaaagag
tttgcttggacggatcagaaattttcatctaaaagtcagaagaagtgcccattaatttat
gaatgtcacataggaatggcacaagaaaaggagggggttggtacttatcttgaattcgct
gaaaatatccttccaagaataaaagctgcaggatataataccattcaaatgatggcaatc
atggagcatccatattatggatcatttggatatcatgtttctaatttttttgctcctaca
tctaggtttggtgatcctgaggatctgaaatttttaataaataaggctcatcaatatggc
attgcagtgataatggatatagttcattcccatgctgtcaaaaatatcaatgaagggttg
aatgagtttgacggctccgaaaatcaatattttcatcctggaccaaaaggatatcatgaa
ggttgggattcaaaattattcgattatggtaaatttgaagtacaacaatttcttctttcc
aatattaggtattggatggaagagtttcattttgatgggtttagatttgatggtgttact
tcagtgatatattatcatcatggccatacagattttgatcatcctgacaaatatttcaat
gatggtgttgatcaagatgcattactttatctccagcttgctaataccttaattcatact
ttttctgaaagtaaaatatctattgcagaagaagtaagtggaatgccaggattatgcaga
gaatgtgaagatggaggaattggttttgattttagattagctatgggaatacctgacttt
tggatcaaaacgatgaagcataagcctgatgagcattgggatatgtttgagatgtggcat
gaattaacgaatcgtccgaaaaatgaaagaacaattgcctatgcagagtctcatgatcaa
gctttggtaggtgataaatctattgctttttggttgatggataaggaaatgtatttcaat
atgggaattgatgacaaaaaccttgttgtcgatcgagggattgcactacataaaatgatc
aggctaattacaattagtttgggaggtgaaggttatctcaatttcattggaaatgaattt
ggacatccagaatgggtggatttcccaagagaaggaaataattggagttatcaatacgct
agacgtcaatggtctttggctgacaatgaatctttgaagtacaaacaacttggattatgg
gataaggcaatgattaaacttattgatgaatttaaagttctaagtgcttcacatgctcaa
caaatttatttagatgcagagaaaaaaattctagcttatgaaagagctgatcttattttc
atatttagcttcaatatatctgaatcattttttggttatgaattgacattgcctaaggtt
ggagactatttaaatattctcaattctgacgattcaaaattcggtggttttgacagaatt
gataataaaattcattattcaacaaataaaaacggagtaataaaactttacttacccaat
aggacttgcatggtacttaaaaagatagaataa

DBGET integrated database retrieval system