KEGG   Belliella baltica: Belba_2926Help
Entry
Belba_2926        CDS       T02134                                 

Definition
transcriptional regulator/sugar kinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
bbd  Belliella baltica
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:bbd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Belba_2926
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Belba_2926
   00052 Galactose metabolism
    Belba_2926
   00500 Starch and sucrose metabolism
    Belba_2926
   00520 Amino sugar and nucleotide sugar metabolism
    Belba_2926
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Belba_2926
   00524 Butirosin and neomycin biosynthesis
    Belba_2926
Enzymes [BR:bbd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Belba_2926
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3137514..3138443)
Genome map
AA seq 309 aa AA seqDB search
MNNKDEHFLGIDVGGTHLKIGLVNRQGEIVAFDKEDTTPYRDDPRGFNPCFVDVVGKYLE
KYPEVRKIGIGLPGLISKDRTTTLEIPAIPALNGFNLKQSLLDKYPNKKFFLENDAAAAA
LGEYRYGTANPPENFLFITMGTGIGSALIMDGEVFKGSRGNAMEMGHMLSRGNEGLERII
GRDGILRIMDRMIRAYPDLAGNDLIGQELGTHLLVDTAKKGNQVSIMVFEEVARVLGEAI
VSAIRILDVTHVYFGGGISAGLEFMMPALDKTVRQFLTKYYVNDLKLAKATLENNAGTLG
AAALCFMEE
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgaataacaaagacgaacattttttgggaatcgatgtgggaggcacgcatttgaagatt
gggcttgtcaatagacagggagaaattgttgcttttgacaaagaagatacaactccctac
agagatgacccaagaggattcaatccatgttttgtggatgttgttgggaaatatttagaa
aaatatcctgaggtaaggaaaattggtattggtttaccaggacttatttcaaaggacaga
actactacattagaaattccagcaattccagctctaaatggttttaatctgaagcaaagc
ttattagataagtatccgaataagaaattttttctagaaaatgatgctgctgccgctgcc
ttaggtgaatatcgctatggaacagcaaatccacccgaaaattttctttttatcaccatg
gggactggaataggaagtgcattaattatggatggagaagttttcaaaggttcacgtggt
aatgccatggaaatggggcatatgctttctagagggaatgaggggttggaaagaattatt
ggtagagacggaatacttagaatcatggataggatgatcagagcatatcctgatttggca
ggaaatgacttgattggacaagaactcggtactcatcttttagtagatacagccaaaaaa
ggcaatcaagtttctattatggtctttgaagaagtagctagagttttaggcgaagcaatc
gtatcggctattcggattttggatgttacacatgtttattttggaggaggaatctcggct
ggattggaatttatgatgcctgctttggataagacagtaagacaattccttaccaaatac
tatgtaaatgaccttaagcttgccaaagcaacacttgaaaataatgccggtaccttagga
gctgctgcgctttgttttatggaggaataa

DBGET integrated database retrieval system