KEGG   Belliella baltica: Belba_3064Help
Entry
Belba_3064        CDS       T02134                                 

Definition
fatty-acid desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
bbd  Belliella baltica
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:bbd00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Belba_3064
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Belba_3064
Enzymes [BR:bbd01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     Belba_3064
Lipid biosynthesis proteins [BR:bbd01004]
 Desaturase
  First
   Belba_3064
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3288151..3288900
Genome map
AA seq 249 aa AA seqDB search
MILIAFFLLHWYFSLFCQSFFLHRYAAHQMFSMSKYWEKFFYIFTWITQGSSYLSPRAYA
VLHRMHHAYSDTPKDPHSPHHTENLFTMMWKTKNIYNDYFSFKLKPEERFSKDVPDWNKF
DLFADSMMARVGWALFYILVYVLSISVFELAGTHWWMYFLLPIHLMMGPVHGAIVNWSGH
KYGYANFDNNDKSKNSLLLDVLMLGELFQNNHHKLPNRPNFAVKWYEFDPTYPIVKILHA
SGIIKLRTT
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
gtgattttaatagctttctttcttcttcattggtatttctctttgttctgtcaaagtttc
ttcctacatcgatacgctgctcatcaaatgttttccatgtctaaatattgggaaaagttc
ttttatatattcacatggattacacaaggaagcagctacttatcccctagagcttatgca
gtacttcatcggatgcatcatgcttatagtgacacgccaaaagacccacacagtccccat
cacacagaaaatttattcacgatgatgtggaaaacaaaaaatatttacaacgattatttc
agcttcaaattaaagccagaagaaagattctcaaaagatgtacctgattggaataagttt
gatctatttgcagattcgatgatggccagagttggatgggctttgttctatatcctagta
tatgttttgtctatctcagtttttgaattggctggtacgcattggtggatgtatttttta
cttcctatacatttgatgatgggacctgttcatggagcaatagtcaactggagtggacat
aaatatggttacgcaaattttgataacaatgacaaatccaaaaatagtcttctacttgat
gttttgatgcttggcgaattatttcaaaataaccatcataagctaccaaacagaccaaac
tttgctgtaaagtggtatgaatttgatccaacttacccaattgtaaaaattttacatgca
agtgggattataaaattaagaaccacataa

DBGET integrated database retrieval system