KEGG   Belliella baltica: Belba_3254Help
Entry
Belba_3254        CDS       T02134                                 

Definition
transcriptional regulator/sugar kinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
bbd  Belliella baltica
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:bbd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Belba_3254
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Belba_3254
   00052 Galactose metabolism
    Belba_3254
   00500 Starch and sucrose metabolism
    Belba_3254
   00520 Amino sugar and nucleotide sugar metabolism
    Belba_3254
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Belba_3254
   00524 Butirosin and neomycin biosynthesis
    Belba_3254
Enzymes [BR:bbd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Belba_3254
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3505811..3506659
Genome map
AA seq 282 aa AA seqDB search
MDINQPILGIDIGGTNIKAGILRKGELSSIKSFPTPALENTETIFKKIFDLISTYSSEEF
HGIGIGVPGLVELSTGKILSINNIPSLINSNLKNYLETQTNLPVKINNDANCFVMGAYRF
GNLKHLNNVVGISLGTGLGAGIITNKNLYSGLNAAAGEWSAIPYLDKTFEDYCSSKFFSK
EYNQTADKLAHLATKGENNAIEAFQQFGIHLAELIKHILYTLSPEGIILGGSISKSHNLF
LDSLKCNLKNCLYPSLVENLTLHISDINEPGIIGAASLHHCK
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atggatataaatcaacccattttgggtattgacataggaggaactaatataaaagctgga
atactacgtaaaggtgaattatcctccattaaaagtttcccgacaccagctctcgagaat
acagaaactattttcaaaaaaatttttgatttaatctctacttattcttcagaagaattt
catggcattggtattggagtacctggattagtagagctatctacaggtaaaattttatct
ataaataatattccttcattgataaattctaacctgaaaaattatctggagactcaaacc
aacttaccagtgaaaattaacaatgatgcaaattgttttgtgatgggggcctacaggttt
gggaatttaaaacatttgaacaacgtagttggaatctctttaggcacaggactcggagcg
ggaatcatcaccaataagaatctttacagcggtctaaacgctgctgccggtgaatggagt
gcaatcccctatttagataaaacttttgaagattactgcagcagcaaatttttctccaaa
gaatataaccaaactgctgacaaactcgcccatctagctactaaaggagagaataatgcc
attgaagcatttcaacaatttggaattcacctagcagaattaatcaaacatatcttatac
accctttctccagaagggattattcttggagggtcaatcagcaaatcacataatttattt
ttagatagtcttaaatgtaaccttaaaaattgtctctatccttctttggttgagaatttg
acacttcatatttctgatataaatgaaccaggaattataggagctgcatctttacatcac
tgcaaatag

DBGET integrated database retrieval system